DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and fzd8b

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_571628.1 Gene:fzd8b / 58072 ZFINID:ZDB-GENE-000328-4 Length:576 Species:Danio rerio


Alignment Length:255 Identity:61/255 - (23%)
Similarity:88/255 - (34%) Gaps:70/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 CSPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPC-DT 448
            |..:.:..||.:|||.|..||...|.:.::...:|..|..||:.:|..:...|:|.:..|.| :.
Zfish    31 CQEISVPLCRGIGYNYTYMPNQFNHDNQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLED 95

  Fly   449 HGSDLQPTPGQICREYCESFMAGC-------GGRLPQRFRQFFDCERFPESTGTQSCHQKPHCVS 506
            :...|.|     ||..||...|||       |...|.|.|    |:..|                
Zfish    96 YKKPLPP-----CRSVCERAKAGCAPLMRQYGFPWPDRMR----CDLLP---------------- 135

  Fly   507 DMQSNVQSPRLCDGYADCPDLSDERSCAFCSPNA--LYCGRGRACVPRKARCDGKADCPDGADEK 569
             :|.:..:  ||..|        .|:.|..||.|  .....|:....:.....|.:.|     |.
Zfish   136 -VQGDPNT--LCMDY--------NRTDATSSPAAPKTTSRPGKPFKRKNKSSPGSSSC-----EP 184

  Fly   570 DCLSIAPLAADLLQPEPLV-----------------PYLSRFHSAGYAVFSEKGVVGKLC 612
            :|...||:........||.                 ||||: ....:|.| ..|:...||
Zfish   185 ECYCRAPMVPVHSDHHPLYNRVKTGQIPNCAMPCHNPYLSQ-EERTFATF-WIGIWSVLC 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 34/124 (27%)
PRKCSH-like <503..>582 CDD:193472 16/80 (20%)
LDLa 536..571 CDD:238060 7/36 (19%)
Tryp_SPc 708..>809 CDD:304450
fzd8bNP_571628.1 CRD_FZ8 27..151 CDD:143570 39/155 (25%)
7tmF_FZD8 221..530 CDD:320378 9/24 (38%)
TM helix 1 230..255 CDD:320378 5/14 (36%)
TM helix 2 264..285 CDD:320378
TM helix 3 314..336 CDD:320378
TM helix 4 357..373 CDD:320378
TM helix 5 395..418 CDD:320378
TM helix 6 446..471 CDD:320378
TM helix 7 491..516 CDD:320378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.