Sequence 1: | NP_001245577.1 | Gene: | CG1632 / 31763 | FlyBaseID: | FBgn0030027 | Length: | 1056 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001074070.1 | Gene: | fzd3b / 567746 | ZFINID: | ZDB-GENE-070122-1 | Length: | 667 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 50/207 - (24%) |
---|---|---|---|
Similarity: | 73/207 - (35%) | Gaps: | 48/207 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 385 CSPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPCDTH 449
Fly 450 GSDLQPTPGQICREYCESFMAGCGGRLPQRFRQFF--------DCERFPESTGTQSCHQKPHCVS 506
Fly 507 DMQSNVQSPRLCDGYADCPDLSDERSCAFCSPNAL-------YCGRG-RACVPRKARCDGKADCP 563
Fly 564 DGADEKDCLSIA 575 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1632 | NP_001245577.1 | SEA | 232..327 | CDD:279699 | |
CRD_FZ | 384..502 | CDD:143549 | 33/124 (27%) | ||
PRKCSH-like | <503..>582 | CDD:193472 | 17/81 (21%) | ||
LDLa | 536..571 | CDD:238060 | 9/42 (21%) | ||
Tryp_SPc | 708..>809 | CDD:304450 | |||
fzd3b | NP_001074070.1 | CRD_FZ | 36..162 | CDD:382974 | 35/144 (24%) |
7tmF_FZD3 | 204..524 | CDD:320161 | 2/11 (18%) | ||
TM helix 1 | 213..238 | CDD:320161 | 1/2 (50%) | ||
TM helix 2 | 247..268 | CDD:320161 | |||
TM helix 3 | 299..325 | CDD:320161 | |||
TM helix 4 | 342..364 | CDD:320161 | |||
TM helix 5 | 378..403 | CDD:320161 | |||
TM helix 6 | 431..456 | CDD:320161 | |||
TM helix 7 | 485..510 | CDD:320161 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |