DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and sfrp2

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001070852.2 Gene:sfrp2 / 566878 ZFINID:ZDB-GENE-061013-293 Length:294 Species:Danio rerio


Alignment Length:168 Identity:45/168 - (26%)
Similarity:66/168 - (39%) Gaps:33/168 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 CSPL--ELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPC- 446
            |.|:  .|..|..:.|.....||||||.:..::.:....:..||..:||.:...|:|.|..|.| 
Zfish    38 CKPIPTNLLLCHDIEYTNMRLPNLLGHETMNEVLQQASSWTPLVQKQCHPDTKKFLCSLFAPVCL 102

  Fly   447 DTHGSDLQPTPGQICREYCESFMAGC-------GGRLPQRFRQFFDCERFPESTGTQSCHQKPHC 504
            |.....:||     ||..|||..:||       |...|    ...||.|||.....        |
Zfish   103 DDLDEPIQP-----CRSLCESVKSGCAPVMAAFGFPWP----DMLDCRRFPLDNDL--------C 150

  Fly   505 VSDMQSNV------QSPRLCDGYADCPDLSDERSCAFC 536
            :....::.      :.||:||...:.|:..:|...:.|
Zfish   151 IPPAGADALVPVTKEVPRVCDACKEKPENDNEIVDSLC 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 37/126 (29%)
PRKCSH-like <503..>582 CDD:193472 8/40 (20%)
LDLa 536..571 CDD:238060 1/1 (100%)
Tryp_SPc 708..>809 CDD:304450
sfrp2NP_001070852.2 CRD_SFRP2 34..161 CDD:143555 38/139 (27%)
NTR_Sfrp1_like 167..294 CDD:239635 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.