DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and AgaP_AGAP005705

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:XP_001688714.1 Gene:AgaP_AGAP005705 / 5667318 VectorBaseID:AGAP005705 Length:311 Species:Anopheles gambiae


Alignment Length:170 Identity:36/170 - (21%)
Similarity:66/170 - (38%) Gaps:41/170 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   682 VGCGELRCGVQSALFNAKQHLSL-----------PKMS---------APGDWPWLVALF---RED 723
            :...|:|...:|.||.||:..|.           |:.:         .|.|.|::|.:.   .:.
Mosquito    33 INWAEVRPVQESPLFKAKRAASFVERYLERVAPAPERTGRINNGVIVGPTDVPYIVGVLVSVEQG 97

  Fly   724 IHVCDGTLITQDWVLTTEGCFQGQPRATWMAIVGAVRLSAKAPW--TQRRRIIGMIKSPVEGSTA 786
            .:.|.|.|:::..|||:..|.:||...|  .::||..::....:  ....|:.....|..:.:..
Mosquito    98 TYFCGGVLVSRTHVLTSATCVEGQTSIT--VLLGASDITRAQDFVVVSHVRVHPDFSSFFQANDL 160

  Fly   787 ALVRLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHV 826
            |::.|.....::|.::...||              |||.|
Mosquito   161 AILTLSRMPRFNDQIQLARLP--------------RRSQV 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 23/114 (20%)
AgaP_AGAP005705XP_001688714.1 Tryp_SPc 72..301 CDD:214473 27/131 (21%)
Tryp_SPc 73..302 CDD:238113 27/130 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.