DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and TMPRSS4

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:540 Identity:114/540 - (21%)
Similarity:183/540 - (33%) Gaps:207/540 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   543 CGRGRACVPRKARCDGKADCPDGADEKDCLSIAPLAADLLQPEPLVPYLSRFHSAGYAVFSEKGV 607
            ||:....:|||..|||:.|||.|.||:.|:...|      :...:...||:..|....:.|..|.
Human    64 CGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFP------EGPAVAVRLSKDRSTLQVLDSATGN 122

  Fly   608 VGKLCAEGLEGDAKLVVRQTVSESLCKSLGYES------VEI-----FDVQNDTERLNDYVRVLD 661
            ....|.:..        .:.::|:.|:.:||.|      |||     .||...||...: :|:.:
Human   123 WFSACFDNF--------TEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQE-LRMRN 178

  Fly   662 PHAPEI--SFIRTHCPRRQVLYVGCGELRCGVQSALFNAKQHLSLPKM-----SAPGDWPWLVAL 719
            ...|.:  |.:..||            |.||         :.|..|::     ::...|||.|::
Human   179 SSGPCLSGSLVSLHC------------LACG---------KSLKTPRVVGVEEASVDSWPWQVSI 222

  Fly   720 FREDIHVCDGTLITQDWVLTTEGCFQGQPRA-TWMAIVGAVRLSAKAPWTQRRRIIGMIKSPV-- 781
            ..:..|||.|:::...||||...||:..... .|....|:.:|.: .|.....:||.:..:|:  
Human   223 QYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGS-FPSLAVAKIIIIEFNPMYP 286

  Fly   782 EGSTAALVRLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVAERLEGQLVSQQRSRLSQ 846
            :.:..||::|:.|:::|..|||||||                                       
Human   287 KDNDIALMKLQFPLTFSGTVRPICLP--------------------------------------- 312

  Fly   847 ENQQFFLIPSQEQQDSSTENQGDEDQDEQEDHFGGESAASYMPKAEALHQELDGYPLPDHAPQVN 911
                ||                    ||:                                    
Human   313 ----FF--------------------DEE------------------------------------ 317

  Fly   912 YYSSSSTVTSSSTAARIATKAPILAAVPAAQEQIWTNCNTLGW-------SRQRDHLQRVQLKMG 969
                                  :..|.|     :|    .:||       .:..|.|.:..:::.
Human   318 ----------------------LTPATP-----LW----IIGWGFTKQNGGKMSDILLQASVQVI 351

  Fly   970 DMAPCENVSIA-----TVNSMCMEATYQKYDCTQEEYSGAPVQCLIPGTNQWALIGVSSWRIACG 1029
            |...| |...|     |...||........|..|.: ||.|   |:..::||.::|:.||...||
Human   352 DSTRC-NADDAYQGEVTEKMMCAGIPEGGVDTCQGD-SGGP---LMYQSDQWHVVGIVSWGYGCG 411

  Fly  1030 PTGVERPRMYDKIASNAAWI 1049
              |...|.:|.|:::...||
Human   412 --GPSTPGVYTKVSAYLNWI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472 16/38 (42%)
LDLa 536..571 CDD:238060 14/27 (52%)
Tryp_SPc 708..>809 CDD:304450 33/103 (32%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060 14/27 (52%)
SRCR_2 108..197 CDD:295335 22/109 (20%)
Tryp_SPc 204..429 CDD:214473 68/362 (19%)
Tryp_SPc 205..432 CDD:238113 70/363 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.