DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and fzd3a

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:XP_005160805.1 Gene:fzd3a / 565921 ZFINID:ZDB-GENE-990415-225 Length:686 Species:Danio rerio


Alignment Length:259 Identity:65/259 - (25%)
Similarity:92/259 - (35%) Gaps:77/259 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 CSPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPCDTH 449
            |.|:.|..|:.:.||.|..||||.|...:..|..:..|..:|:.||..|...|:|.|..|.|..:
Zfish    30 CEPITLRMCQGLAYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLECSTEIRPFLCALYAPVCTEY 94

  Fly   450 GSDLQPTPGQICREYCESFMAGC-------GGRLPQRFRQFFDCERFPESTGTQSCHQK-PHCVS 506
            |....|     ||..|:...:.|       |...|..    .:|.||||      |.:. |..:.
Zfish    95 GRVTLP-----CRRLCQRAKSDCYKLMEMFGVSWPDE----MECSRFPE------CEESYPRAID 144

  Fly   507 DMQSNVQSPRLCDGYADCPDLSDERSCAFCSPNAL-------YCGRG-RACVPRKARCDGKADCP 563
            .:.|:       |...:.|. :.:|...|..|..|       |...| |.|.|         .||
Zfish   145 LLPSS-------DSTEESPS-AVQRDYGFWCPRELKIEPDLGYSFMGVRDCSP---------PCP 192

  Fly   564 DGADEKD----------CLSIAPLAADLL-------------QPE-PLVPYLSRFHSAGYAVFS 603
            :....||          .:||..|:|.|.             .|| |::     |::..|.:.|
Zfish   193 NMYFRKDELIFARYFIGVISIVCLSATLFTFLTFLIDVGRFRYPERPII-----FYAVCYMMVS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 37/124 (30%)
PRKCSH-like <503..>582 CDD:193472 20/96 (21%)
LDLa 536..571 CDD:238060 11/52 (21%)
Tryp_SPc 708..>809 CDD:304450
fzd3aXP_005160805.1 CRD_FZ3 26..152 CDD:143558 40/143 (28%)
Frizzled 195..513 CDD:279827 13/62 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.