Sequence 1: | NP_001245577.1 | Gene: | CG1632 / 31763 | FlyBaseID: | FBgn0030027 | Length: | 1056 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017229.1 | Gene: | pik3r3 / 549983 | XenbaseID: | XB-GENE-6464721 | Length: | 461 | Species: | Xenopus tropicalis |
Alignment Length: | 205 | Identity: | 38/205 - (18%) |
---|---|---|---|
Similarity: | 76/205 - (37%) | Gaps: | 72/205 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 128 TQQRERERERDRDRERERERDRER-----DREREREHQLHMHQHNHGLRRKSESVLSTDSDIRFT 187
Fly 188 RRKLGDGQKCGCAVIAGFLIALLVAGIFVYVGYTYFRPEPLPDRVFRGRFMVLNDKWSMELANQN 252
Fly 253 SMRFQHKARDYRERIN--LTLRRSDLREAYEGSEILALDGSEDNNNIVVHFNMIFDPYAGLVSSG 315
Fly 316 DLLALFHEEM 325 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1632 | NP_001245577.1 | SEA | 232..327 | CDD:279699 | 23/96 (24%) |
CRD_FZ | 384..502 | CDD:143549 | |||
PRKCSH-like | <503..>582 | CDD:193472 | |||
LDLa | 536..571 | CDD:238060 | |||
Tryp_SPc | 708..>809 | CDD:304450 | |||
pik3r3 | NP_001017229.1 | SH2_nSH2_p85_like | 59..167 | CDD:198195 | |
iSH2_PI3K_IA_R | 172..332 | CDD:355389 | 24/149 (16%) | ||
SH2_cSH2_p85_like | 351..454 | CDD:198184 | 8/27 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |