DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and pik3r3

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001017229.1 Gene:pik3r3 / 549983 XenbaseID:XB-GENE-6464721 Length:461 Species:Xenopus tropicalis


Alignment Length:205 Identity:38/205 - (18%)
Similarity:76/205 - (37%) Gaps:72/205 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 TQQRERERERDRDRERERERDRER-----DREREREHQLHMHQHNHGLRRKSESVLSTDSDIRFT 187
            ||:|..:...:|......|::.||     ::.:.|..::|            :|.|..:.|:   
 Frog   232 TQERYSKEYMERFNREGNEKEMERIIMNYEKLKSRLGEIH------------DSKLRLEQDL--- 281

  Fly   188 RRKLGDGQKCGCAVIAGFLIALLVAGIFVYVGYTYFRPEPLPDRVFRGRFMVLNDKWSMELANQN 252
            :::..|.::                   :.......:|:.:..|..|.:::|    |    .|..
 Frog   282 KKQALDNRE-------------------IDKKMNSIKPDLIQLRKIRDQYLV----W----LNHK 319

  Fly   253 SMRFQHKARDYRERIN--LTLRRSDLREAYEGSEILALDGSEDNNNIVVHFNMIFDPYAGLVSSG 315
            .:|        ::|||  |.::..::.:.|..||       ||:|  :.|    :|.....|  |
 Frog   320 GVR--------QKRINDWLGIKNENIDDTYFVSE-------EDDN--LPH----YDEKTWFV--G 361

  Fly   316 DLLALFHEEM 325
            ||..:..||:
 Frog   362 DLNRIQAEEL 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699 23/96 (24%)
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450
pik3r3NP_001017229.1 SH2_nSH2_p85_like 59..167 CDD:198195
iSH2_PI3K_IA_R 172..332 CDD:355389 24/149 (16%)
SH2_cSH2_p85_like 351..454 CDD:198184 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.