Sequence 1: | NP_001245577.1 | Gene: | CG1632 / 31763 | FlyBaseID: | FBgn0030027 | Length: | 1056 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001025468.1 | Gene: | Tmprss11c / 435845 | MGIID: | 3521861 | Length: | 431 | Species: | Mus musculus |
Alignment Length: | 207 | Identity: | 56/207 - (27%) |
---|---|---|---|
Similarity: | 88/207 - (42%) | Gaps: | 34/207 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 621 KLVVRQTVSESLCKSLG----YESVEIF---DVQNDTERLND-----YVRVLDPHAPEISFIRTH 673
Fly 674 CPRRQVLYVGCGELRCGVQSALFNAKQHLSLPKMSAPGDWPWLVALFREDIHVCDGTLITQDWVL 738
Fly 739 TTEGCF--QGQPRATWMAIVGAVRLSAKAPWTQRRRIIGMIKS-PVEGSTAALVRLETPVSYSDH 800
Fly 801 VRPICLPDALQR 812 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1632 | NP_001245577.1 | SEA | 232..327 | CDD:279699 | |
CRD_FZ | 384..502 | CDD:143549 | |||
PRKCSH-like | <503..>582 | CDD:193472 | |||
LDLa | 536..571 | CDD:238060 | |||
Tryp_SPc | 708..>809 | CDD:304450 | 34/103 (33%) | ||
Tmprss11c | NP_001025468.1 | SEA | 62..157 | CDD:279699 | 7/31 (23%) |
Tryp_SPc | 199..425 | CDD:214473 | 39/129 (30%) | ||
Tryp_SPc | 200..428 | CDD:238113 | 39/128 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167834063 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |