DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:352 Identity:61/352 - (17%)
Similarity:95/352 - (26%) Gaps:156/352 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   708 SAPGDWPWLVALFREDIHVCDGTLITQDWVLTTEGCFQGQPRATWMAIVGAVRLSAKAPWTQRRR 772
            |..|:| |           |.|::|...||||...|..|....|                     
  Fly    56 SGNGNW-W-----------CGGSIIGNTWVLTAAHCTNGASGVT--------------------- 87

  Fly   773 IIGMIKSPVEGSTAALVRLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVAERLEGQLV 837
                                  ::|...:|             .||  |....|.     .|.::
  Fly    88 ----------------------INYGASIR-------------TQP--QYTHWVG-----SGDII 110

  Fly   838 SQQRSRLSQENQQFFLIPSQEQQDSSTENQGD--EDQDEQEDHFGGESAAS-----YMPKAEALH 895
            ..........:....||.:......|..|:.:  ...|..:|:.|..:.||     |        
  Fly   111 QHHHYNSGNLHNDISLIRTPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTY-------- 167

  Fly   896 QELDGYPLPDHAPQVNYYSSSSTVTSSSTAARIATKAPILAAVPAAQEQIWTNCNTLGWSRQRDH 960
               ||.||||                                                |      
  Fly   168 ---DGSPLPD------------------------------------------------W------ 175

  Fly   961 LQRVQLKMGDMAPCENVSIATVNSMCMEATYQKYDCTQEEYSGAPVQCLIPGTNQWALIGVSSWR 1025
            ||.|.:::...:.|........|.:|:.....|..|..:  ||.|:  :....|:  |:||:|:.
  Fly   176 LQSVDVQIISQSDCSRTWSLHDNMICINTDGGKSTCGGD--SGGPL--VTHDGNR--LVGVTSFG 234

  Fly  1026 IACG-PTGVERPRMYDKIASNAAWIRE 1051
            .|.| .:|.  |.::.::.....|||:
  Fly   235 SAAGCQSGA--PAVFSRVTGYLDWIRD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 16/100 (16%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 61/352 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.