DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and CG7432

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:610 Identity:115/610 - (18%)
Similarity:191/610 - (31%) Gaps:219/610 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 PESTGTQSCHQK------PHCVSDMQSNVQSPRLCDGYADCPDLSDERSCAFCSPNALYCGRGRA 548
            |.:.|.|...||      |. .:...:..::|..........:.|||........|  ||   :.
  Fly   279 PVAQGAQQSQQKIKIPTTPR-TTTTSTTTEAPITLTPLDQLAEASDEAGTGKDVEN--YC---KT 337

  Fly   549 CVPRKARCDGKADCPDGADEKDCLSIAPLAADLLQPEPLVP-YLSRFHSAGYAVFSEKGVVGKLC 612
            ...|:.||:..:.||     ...|:::.|...|......|| ......|:...:.::|.:     
  Fly   338 PSGRRGRCEDLSSCP-----ALLLNLSSLRESLCFKSLYVPGVCCPISSSSTVLTTQKPL----- 392

  Fly   613 AEGLEGDAKLVVRQTVSESLCKSLGYESVEIFDVQNDTERLNDYVRVLDPHAP-EISFIRTHCPR 676
                    :|..|.|.:.|..|:.  :..:...|:..|...:..|.:.....| ..:...|..|.
  Fly   393 --------RLTTRPTTTTSTTKAT--QPTKKSTVRPTTRPTSGLVLIPQKKPPTTTTTTTTEVPL 447

  Fly   677 RQVLYVGCGEL--------RCGVQSALFNAKQHLSLPK----MSAP-GDWPWLVALFREDIH--- 725
            ..   .|..|:        .||        :|..|..:    :.|| |.|||:.|:|   :|   
  Fly   448 EP---EGLDEIGNNIVDPDECG--------QQEYSTGRIVGGVEAPNGQWPWMAAIF---LHGPK 498

  Fly   726 ----VCDGTLITQDWVLTTEGCFQGQPRATWMA-----IVGAVRLSAKA----PWT--------- 768
                .|.|:||...::||...|.:...:..:.|     .:|.:.||..|    |.|         
  Fly   499 RTEFWCGGSLIGTKYILTAAHCTRDSRQKPFAARQFTVRLGDIDLSTDAEPSDPVTFAVKEVRTH 563

  Fly   769 QRRRIIGMIKSPVEGSTAALVRLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVAERLE 833
            :|...||..      :..|::.|:.||..|.:|.|:|||..::              :|..|||.
  Fly   564 ERFSRIGFY------NDIAILVLDKPVRKSKYVIPVCLPKGIR--------------MPPKERLP 608

  Fly   834 GQLVSQQRSRLSQENQQFFLIPSQEQQDSSTENQGDEDQDEQEDHFGGESAASYMPKAEALHQEL 898
            |                         :.::....|       ..::||:                
  Fly   609 G-------------------------RRATVVGWG-------TTYYGGK---------------- 625

  Fly   899 DGYPLPDHAPQVNYYSSSSTVTSSSTAARIATKAPILAAVPAAQEQIWTN--CNTLGWSRQRDHL 961
                                   .||:.|            .|:..||.|  |:       |.:.
  Fly   626 -----------------------ESTSQR------------QAELPIWRNEDCD-------RSYF 648

  Fly   962 QRVQLKMGDMAPCENVSIATVNSMCMEATYQKYDCTQEEYSGAPVQCLIPGTNQWALIGVSSWRI 1026
            |.:                ..|.:|...:....|..|.: ||.|:  ::...:.|..:||.|:..
  Fly   649 QPI----------------NENFICAGYSDGGVDACQGD-SGGPL--MMRYDSHWVQLGVVSFGN 694

  Fly  1027 ACGPTGVERPRMYDKIASNAAWIRE 1051
            .||..|.  |.:|.::.....|||:
  Fly   695 KCGEPGY--PGVYTRVTEYLDWIRD 717

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 5/17 (29%)
PRKCSH-like <503..>582 CDD:193472 14/78 (18%)
LDLa 536..571 CDD:238060 8/34 (24%)
Tryp_SPc 708..>809 CDD:304450 36/126 (29%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829 11/50 (22%)
Tryp_SPc 474..715 CDD:214473 70/374 (19%)
Tryp_SPc 475..718 CDD:238113 73/377 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.