DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Sb

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster


Alignment Length:261 Identity:61/261 - (23%)
Similarity:98/261 - (37%) Gaps:71/261 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   662 PHAPEISFIRTHCPRRQVLYVGCGELRCGVQSALFNAKQHLSLPKMSAPGDWPWLVALFR----- 721
            |.|..:..::|         :......|||.: |...:..:...|.:|.|.|||.|::.|     
  Fly   514 PDAGALGHVKT---------ISAARSECGVPT-LARPETRIVGGKSAAFGRWPWQVSVRRTSFFG 568

  Fly   722 -EDIHVCDGTLITQDWVLTTEGCFQGQPRATWMAIVGAVRL----------SAKAPWTQRRRIIG 775
             ...|.|.|.||.::|:.|...|...       .::..:|:          ..:.|:.:|    |
  Fly   569 FSSTHRCGGALINENWIATAGHCVDD-------LLISQIRIRVGEYDFSHVQEQLPYIER----G 622

  Fly   776 MIKSPVEGSTA--------ALVRLETPVSYSDHVRPICLP--DAL----------QRRLLQ---Q 817
            :.|..|....:        |||:||.|:.::.||.|||||  |:|          ..||.:   .
  Fly   623 VAKKVVHPKYSFLTYEYDLALVKLEQPLEFAPHVSPICLPETDSLLIGMNATVTGWGRLSEGGTL 687

  Fly   818 PPAQRRSHVPVAERLEGQLVSQQRSRLSQENQQF----FLIPSQEQ--QDSSTENQGDEDQDEQE 876
            |...:...||:......:.:..:..|     |:|    ||....|.  |||...:.|...|.:.:
  Fly   688 PSVLQEVSVPIVSNDNCKSMFMRAGR-----QEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQ 747

  Fly   877 D 877
            |
  Fly   748 D 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 34/126 (27%)
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 54/222 (24%)
Tryp_SPc 544..785 CDD:238113 54/221 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444239
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.