DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and CG11668

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:365 Identity:74/365 - (20%)
Similarity:102/365 - (27%) Gaps:170/365 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 GTQSCHQKP---------HCVSDMQSNVQSPRLCDGYADCPDLSDERSCAFCSPNALYCGRGRAC 549
            |....|.:|         .|:|.||:   .||:      .|.|     |....||.|.|      
  Fly    42 GNCQAHDRPLIGKCVRYVDCISAMQA---VPRV------TPLL-----CPSSWPNQLVC------ 86

  Fly   550 VPRKARCDGKADCPDGADEKDCLSIAPLAADLLQPEPLVPYLSRFHSAGYAVFSEKGVVGKLCAE 614
                        ||.|             ..||.|    |.:|:...|              ||.
  Fly    87 ------------CPHG-------------GYLLPP----PSISKSEQA--------------CAN 108

  Fly   615 GL-EGDAKLVVRQTVSESLCKSLGYESVEIFDVQNDTERLNDYVRVLDPHAPEISFIRTHCPRRQ 678
            .. ....|...|:                    :|...:| |.|.:::|      .|:.| .:.|
  Fly   109 AYPRAHHKRRRRR--------------------RNTNPKL-DQVELVEP------IIQKH-NQSQ 145

  Fly   679 VLYVGCGELRCGVQSALFNAKQHLSLPKMSAPGDWP-----WLVALFREDIHV-----------C 727
            .|.||         ..|....:|   |.|.|.| ||     |        ||.           |
  Fly   146 NLLVG---------GRLTQENEH---PYMCALG-WPSRTNRW--------IHEHGSSKRRYTFNC 189

  Fly   728 DGTLITQDWVLTTEGCFQGQPRATWMAIVGAVRL-SAKAPWTQRRRIIGMIKSPVEGST--AALV 789
            ...:|...:.:|...|......:..:|::|.|.| |.:....:.:||........|..|  .|:|
  Fly   190 GCAMIAPRFAITAAHCASVGGESPSVALIGGVELNSGRGQLIEIKRISQHPHFDAETLTNDLAVV 254

  Fly   790 RLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVA 829
            :|                             .||||:|||
  Fly   255 KL-----------------------------ARRSHMPVA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 2/7 (29%)
PRKCSH-like <503..>582 CDD:193472 16/78 (21%)
LDLa 536..571 CDD:238060 7/34 (21%)
Tryp_SPc 708..>809 CDD:304450 23/119 (19%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 36/167 (22%)
Tryp_SPc 149..392 CDD:214473 36/167 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.