DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and CG14642

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster


Alignment Length:370 Identity:66/370 - (17%)
Similarity:123/370 - (33%) Gaps:147/370 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   707 MSAPGDWPWLVAL-FRED----IHVCDGTLITQDWVLTTEGC---FQGQPRATWMAI----VGAV 759
            ::.||::|.:.|: |..|    .:.|.|:||::.:|||...|   ::..|:  |:.|    :.:.
  Fly   149 LARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPK--WVRIGDLDLASE 211

  Fly   760 RLSAKAPWTQRRRIIG--MIKSPVEGSTAALVRLETPVSYSDHVRPICLPDALQRRLLQQPPAQR 822
            :.|.:|...:..::..  ..|..:.....||::||..|..:::|||:                  
  Fly   212 KRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPV------------------ 258

  Fly   823 RSHVPVAERLEGQLVSQQRSRLSQENQQFFLIPSQEQQDSSTENQGDEDQDEQEDHFGGESAASY 887
                                       :.::.|.                               
  Fly   259 ---------------------------RLWVFPE------------------------------- 265

  Fly   888 MPKAEALHQELDGYPLPDHA-PQVNYYSSSSTVTSSSTAARIATKAPILAAVPAAQEQIWTNCNT 951
            :|...|...   ||.....| |..|..::.:                 |..||.|:      || 
  Fly   266 LPTTIAFAM---GYGATSFAKPMTNRLTNLN-----------------LTVVPNAE------CN- 303

  Fly   952 LGWSRQRDHLQRVQLKMGDMAP-CENVSIATVNSMCMEATYQKYDCTQEEYSGAPVQCLIPGTNQ 1015
                             .::.| .|..|....:.:|.:......|..|.: ||.|:|..:||..:
  Fly   304 -----------------AELPPLAETPSGVLESQICAQDYILNRDTCQGD-SGGPLQLNLPGRRR 350

  Fly  1016 -----WALIGVSSWRIACGPTGVERPRMYDKIASNAAWIRETISA 1055
                 :.|||::|:.:.|..:   .|.:|.:::|...||..|:.|
  Fly   351 GHRIHYHLIGITSYGVFCRSS---YPSVYTRVSSFLDWIELTVWA 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 28/114 (25%)
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 63/363 (17%)
Tryp_SPc 146..386 CDD:214473 62/362 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.