Sequence 1: | NP_001245577.1 | Gene: | CG1632 / 31763 | FlyBaseID: | FBgn0030027 | Length: | 1056 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001137989.2 | Gene: | CG10587 / 40318 | FlyBaseID: | FBgn0037039 | Length: | 289 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 44/206 - (21%) |
---|---|---|---|
Similarity: | 71/206 - (34%) | Gaps: | 74/206 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 715 WLVALFREDIHVCDGTLITQDWVLTTEGCFQGQPR-ATWMAIVGAVRLSAKAPWTQRRRII--GM 776
Fly 777 IKSPVEGSTAALVRLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVAERLEGQLVSQQR 841
Fly 842 SRLSQENQQFFLIPSQEQQDSS---TENQGDEDQDEQEDHFGGES---------------AASYM 888
Fly 889 PKAEALHQELD 899 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1632 | NP_001245577.1 | SEA | 232..327 | CDD:279699 | |
CRD_FZ | 384..502 | CDD:143549 | |||
PRKCSH-like | <503..>582 | CDD:193472 | |||
LDLa | 536..571 | CDD:238060 | |||
Tryp_SPc | 708..>809 | CDD:304450 | 26/96 (27%) | ||
CG10587 | NP_001137989.2 | Tryp_SPc | 45..278 | CDD:214473 | 44/206 (21%) |
Tryp_SPc | 46..280 | CDD:238113 | 44/206 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45444241 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |