DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and CG10587

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:206 Identity:44/206 - (21%)
Similarity:71/206 - (34%) Gaps:74/206 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   715 WLVALFREDIHVCDGTLITQDWVLTTEGCFQGQPR-ATWMAIVGAVRLSAKAPWTQRRRII--GM 776
            :|:||..|...||.|||:....|||...||.|:.: :.|:|:.||.:|:.:....|.:.:|  ..
  Fly    60 YLIALRYEMNFVCGGTLLHDLIVLTAAHCFLGRVKISDWLAVGGASKLNDRGIQRQVKEVIKSAE 124

  Fly   777 IKSPVEGSTAALVRLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVAERLEGQLVSQQR 841
            .:........|::||:.|:.                                 .:..|||:..::
  Fly   125 FREDDMNMDVAILRLKKPMK---------------------------------GKSLGQLILCKK 156

  Fly   842 SRLSQENQQFFLIPSQEQQDSS---TENQGDEDQDEQEDHFGGES---------------AASYM 888
            .          |:|..|.:.|.   |||          ..||.:.               .|||:
  Fly   157 Q----------LMPGTELRVSGWGLTEN----------SEFGPQKLLRTVTVPVVDKKKCRASYL 201

  Fly   889 PKAEALHQELD 899
            |.....|:..|
  Fly   202 PTDWESHKHFD 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 26/96 (27%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 44/206 (21%)
Tryp_SPc 46..280 CDD:238113 44/206 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444241
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.