DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and CG9372

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:380 Identity:69/380 - (18%)
Similarity:114/380 - (30%) Gaps:160/380 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   689 CGVQSALFNAKQHLSLPKMSAPGDWPWLVALFREDIHV--CDGTLITQDWVLTTEGCFQGQPRAT 751
            ||:.|..|   ..|:..:.:.|.:|||:.||.:|.:..  |.|.|||...|||...|...:.:..
  Fly   164 CGITSRQF---PRLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKED 225

  Fly   752 WMAIVGAVRLSAKAPWTQRR--RIIGMI----KSPVE-GSTAALVRLETPVSYSDHVRPICLPDA 809
            ....:|... :.....|:.|  ||..|:    .:|.. .:..|:||::....::.::.|:|:|  
  Fly   226 IFVRLGEYN-THMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMP-- 287

  Fly   810 LQRRLLQQPPAQRRSHVPVAERLEGQLVSQQRSRLSQENQQFFLIPSQEQQDSSTENQGDEDQDE 874
                             ||                                        :||   
  Fly   288 -----------------PV----------------------------------------NED--- 292

  Fly   875 QEDHFGGESAASYMPKAEALHQELDGYPLPDHAPQVNYYSSSSTVTSSSTAARIATKAPILAAVP 939
                                                                             
  Fly   293 ----------------------------------------------------------------- 292

  Fly   940 AAQEQIWTNCNTL--GWSRQR------DHLQRVQLKMGDMAPCENVSIATV--NSMCMEATYQKY 994
                  |::.|.:  ||..|:      :.|..|.|.:...:.|.:..:..|  .:||........
  Fly   293 ------WSDRNAIVTGWGTQKFGGPHSNILMEVNLPVWKQSDCRSSFVQHVPDTAMCAGFPEGGQ 351

  Fly   995 DCTQEEYSGAPVQCLIPGTNQWALIGVSSWRIACGPTGVERPRMYDKIASNAAWI 1049
            |..|.: ||.|:...:| ..:|..||:.||.:.||..|  ||.:|.::.....||
  Fly   352 DSCQGD-SGGPLLVQLP-NQRWVTIGIVSWGVGCGQRG--RPGIYTRVDRYLDWI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 29/109 (27%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 63/366 (17%)
Tryp_SPc 176..402 CDD:238113 62/363 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.