DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and fz2

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001262037.1 Gene:fz2 / 40090 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster


Alignment Length:155 Identity:44/155 - (28%)
Similarity:69/155 - (44%) Gaps:17/155 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 MSSSPLGGHDETTEPV----VTTTPAPPR-RCSPLELSYCRQVGYNITTYPNLLGHASYEQLAED 418
            |....:|||.....|.    |...|..|. ||..:.:..||.:|||:|::||.:.|.:.::...:
  Fly    33 MGGMGMGGHGLDASPAPGYGVPVIPKDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLE 97

  Fly   419 VIVFRELVDGECHREAYDFVCRLLQPPC--DTHGSDLQPTPGQICREYCESFMAGCGGRLPQ--- 478
            |..|..||:.:|..:...|:|.:..|.|  |.|    :|.|  :||..||...:||...:.|   
  Fly    98 VHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYH----KPLP--VCRSVCERARSGCAPIMQQYSF 156

  Fly   479 RFRQFFDCERFP-ESTGTQSCHQKP 502
            .:.:...||..| .......|.::|
  Fly   157 EWPERMACEHLPLHGDPDNLCMEQP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 35/123 (28%)
PRKCSH-like <503..>582 CDD:193472 44/155 (28%)
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 36/125 (29%)
Frizzled 308..618 CDD:279827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.