DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and CG10472

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:396 Identity:69/396 - (17%)
Similarity:126/396 - (31%) Gaps:164/396 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   690 GVQSALFNAKQHLS----LPK---------------MSAPGDWPWLVALFREDIHV------CDG 729
            |.|:..:|:.::|:    :||               ::.|..:|:.|.|.   :::      |.|
  Fly    16 GAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLL---LYITGGAAWCGG 77

  Fly   730 TLITQDWVLTTEGCFQGQPRATWMAIVGAVRLSAKAP-----WTQRRRII---GMIKSPVEGSTA 786
            |:|:..|::|...|.........:.:....|.:||..     :.:.:.:|   ..|...:. :..
  Fly    78 TIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETIT-NDI 141

  Fly   787 ALVRLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVAERLEGQLVSQQRSRLSQENQQF 851
            :|::|..|:.::.:::|..||                                            
  Fly   142 SLIKLPVPIEFNKYIQPAKLP-------------------------------------------- 162

  Fly   852 FLIPSQEQQDS-STENQGDEDQDEQEDHFGGESAASYMPKAEALHQELDGYPLPDHAPQVNYYSS 915
                  .:.|| ||              :|||:|.:                           |.
  Fly   163 ------VKSDSYST--------------YGGENAIA---------------------------SG 180

  Fly   916 SSTVTSSSTAARIATKAPILAAVPAAQEQIWTNCNTLGWSRQRDHLQRVQLKMGDMAPCENVSIA 980
            ...::.|:|.   ||.....|.||     |..|.....|                     ...:.
  Fly   181 WGKISDSATG---ATDILQYATVP-----IMNNSGCSPW---------------------YFGLV 216

  Fly   981 TVNSMCMEATYQKYDCTQEEYSGAPVQCLIPGTNQWALIGVSSWRIACGPTGVERPRMYDKIASN 1045
            ..:::|::.|.....|..:  ||.|: .|..|:|  .|||.:|:.||.| ..|..|.::.:|...
  Fly   217 AASNICIKTTGGISTCNGD--SGGPL-VLDDGSN--TLIGATSFGIALG-CEVGWPGVFTRITYY 275

  Fly  1046 AAWIRE 1051
            ..||.|
  Fly   276 LDWIEE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 22/114 (19%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 60/362 (17%)
Tryp_SPc 47..282 CDD:238113 63/365 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.