DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Tmprss4

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:527 Identity:100/527 - (18%)
Similarity:169/527 - (32%) Gaps:181/527 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   543 CGRGRACVPRKARCDGKADCPDGADEKDCLSIAPLAADLLQPEPLVPYLSRFHSAGYAVFSEKGV 607
            ||.....:||...|||..||..|.||:.|:...|      :...:...||:..|....:.:.:|.
  Rat   105 CGNPLTFIPRGQMCDGHLDCASGEDEEHCVKNFP------EKPGVTVRLSKDRSTLQVLDAARGT 163

  Fly   608 VGKLCAEGLEGDAKLVVRQTVSESLCKSLGYESVEIFDVQNDTERLNDYVRVLDPHAPEISFIRT 672
            ...:|.:..        .:.::::.|:.:||.|...|   ...|...:...::.|.......::.
  Rat   164 WASVCFDNF--------TEALAKTACRQMGYNSQPAF---GPVEMGPNQTLLVTPVTGNSQELQM 217

  Fly   673 HCPRRQVLYVGCGELRCGVQSALFNAKQHLSLPKM-----SAPGDWPWLVALFREDIHVCDGTLI 732
            ....|..|......|||      .:..:.|...::     ::...|||.|::.....|||.|:::
  Rat   218 QNGSRSCLSGSLVSLRC------LDCGKSLKTTRVVGGVEASADSWPWQVSIQYNKQHVCGGSIL 276

  Fly   733 TQDWVLTTEGCFQGQ-PRATWMAIVGAVRLSAKAPWTQRRRIIGMIKSPVE--GSTAALVRLETP 794
            ...|:||...||:.. ..::|....|:.:| ..:|.....:|.....:|::  ....|||:|:.|
  Rat   277 DHHWILTAAHCFRKYLDVSSWKVRAGSNKL-GNSPSLPVAKIFIAEPNPLQPKEKDIALVKLKMP 340

  Fly   795 VSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVAERLEGQLVSQQRSRLSQENQQFFLIPSQEQ 859
            :::|..|||||||                                    .|.|.    |||:   
  Rat   341 LTFSGSVRPICLP------------------------------------FSDEE----LIPT--- 362

  Fly   860 QDSSTENQGDEDQDEQEDHFGGESAASYMPKAEALHQELDGYPLPDHAPQVNYYSSSSTVTSSST 924
                                        ||                                   
  Rat   363 ----------------------------MP----------------------------------- 364

  Fly   925 AARIATKAPILAAVPAAQEQIWTNCNTLGW-------SRQRDHLQRVQLKMGDMAPCENVSIA-- 980
                                :|    .:||       .:..|.|.:..:::.|.|.| |...|  
  Rat   365 --------------------VW----VIGWGFTEENGGKMSDTLLQASVQVIDSARC-NAEDAYQ 404

  Fly   981 ---TVNSMCMEATYQKYDCTQEEYSGAPVQCLIPGTNQWALIGVSSWRIACGPTGVERPRMYDKI 1042
               |...:|........|..|.: ||.|   |:...::|.::|:.||...||....  |.:|.|:
  Rat   405 GEVTAGMLCAGTPQGGKDTCQGD-SGGP---LMYHYDKWQVVGIVSWGYGCGSPST--PGVYTKV 463

  Fly  1043 ASNAAWI 1049
            .:...||
  Rat   464 TAYLDWI 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472 14/38 (37%)
LDLa 536..571 CDD:238060 12/27 (44%)
Tryp_SPc 708..>809 CDD:304450 32/103 (31%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060 12/27 (44%)
SRCR_2 149..238 CDD:413346 15/105 (14%)
Tryp_SPc 245..470 CDD:214473 66/362 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.