DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and zetaTry

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster


Alignment Length:151 Identity:35/151 - (23%)
Similarity:54/151 - (35%) Gaps:57/151 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 DGSEDN-NNIVVHFNMIFDPYAGLVSSGDLLALFHEEMTQPPQQRRHFANMTVDVASLSIKETTG 352
            ||...| ..||:|...    |:|...:.|:..||    ..||....:|   |:....|::::   
  Fly   110 DGVITNVKEIVMHEGY----YSGAAYNNDIAILF----VDPPLPLNNF---TIKAIKLALEQ--- 160

  Fly   353 LIEEPIMSSSPLGGHDETTEPVVTTTPAPPRRCSPLELSYCRQVGYNITTYPNLLGHASYEQLAE 417
                                              |:|.:..:..|:. ||.|.  |::|.:.||.
  Fly   161 ----------------------------------PIEGTVSKVSGWG-TTSPG--GYSSNQLLAV 188

  Fly   418 DV-IVFRELVDGECHREAYDF 437
            || ||..||    |.::..||
  Fly   189 DVPIVSNEL----CDQDYEDF 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699 11/38 (29%)
CRD_FZ 384..502 CDD:143549 19/55 (35%)
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 35/151 (23%)
Tryp_SPc 39..276 CDD:238113 35/151 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.