DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and TMPRSS9

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001382442.1 Gene:TMPRSS9 / 360200 HGNCID:30079 Length:1093 Species:Homo sapiens


Alignment Length:710 Identity:119/710 - (16%)
Similarity:197/710 - (27%) Gaps:316/710 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   536 CSPNALYCGRGRACVPRKARCDGKADCPDGADEKDCLSIAPLAADLLQPEPLVPYLSRFHSAGYA 600
            |..|:..||..:........||.:.||.||:||                                
Human   188 CPGNSFSCGNSQCVTKVNPECDDQEDCSDGSDE-------------------------------- 220

  Fly   601 VFSEKGVVGKLCAEGLEGDAKLVVRQTVSESLCKSLGYESVEIFDVQNDTERLNDYVRVLDPHAP 665
                                                                             
Human   221 ----------------------------------------------------------------- 220

  Fly   666 EISFIRTHCPRRQVLYVGCGELRCGVQSALFNAKQHLSLPKMSAPGDWPWLVALFREDIHVCDGT 730
                  .||             .||:|.|...|.:.:...:.| ||::||..:|.....|.|...
Human   221 ------AHC-------------ECGLQPAWRMAGRIVGGMEAS-PGEFPWQASLRENKEHFCGAA 265

  Fly   731 LITQDWVLTTEGCF-QGQPRATWMAIVGAVRLSAKAPWTQRRRIIGMIKSPV-EGSTA----ALV 789
            :|...|:::...|| :.|....|:|.|||..||.....|.|.:::.::|.|: ...||    |::
Human   266 IINARWLVSAAHCFNEFQDPTKWVAYVGATYLSGSEASTVRAQVVQIVKHPLYNADTADFDVAVL 330

  Fly   790 RLETPVSYSDHVRPICLPDA-----------------LQRRLLQQPPAQRRSHVPVAER------ 831
            .|.:|:.:..|::|:|||.|                 |:...|.:|...:::.|.:.::      
Human   331 ELTSPLPFGRHIQPVCLPAATHIFPPSKKCLISGWGYLKEDFLVKPEVLQKATVELLDQALCASL 395

  Fly   832 --------------LEGQLVSQQRSR-----LSQENQQFFL------------------------ 853
                          |:|::.|.|...     ..:.:.:|||                        
Human   396 YGHSLTDRMVCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGVYARVTR 460

  Fly   854 -----------------------------------------IPSQEQQDSST------------- 864
                                                     .|::..|..||             
Human   461 LRDWILEATTKASMPLAPTMAPAPAAPSTAWPTSPESPVVSTPTKSMQALSTVPLDWVTVPKLQE 525

  Fly   865 ----------------------ENQGDEDQDEQEDHFGG---------------------ESAAS 886
                                  |........|...||.|                     |...:
Human   526 CGARPAMEKPTRVVGGFGAASGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVEQVRA 590

  Fly   887 YMPKAEALHQELDGYPL----------PDHAPQVNYYSSSSTVTSSSTAARIATKAPILAAVPAA 941
            ::..|..|  .|.|.|:          |.:.|.:..:..:....:|..|.....: |:...:...
Human   591 HLGTASLL--GLGGSPVKIGLRRVVLHPLYNPGILDFDLAVLELASPLAFNKYIQ-PVCLPLAIQ 652

  Fly   942 QEQIWTNCNTLGWSRQRDH-------LQRVQLKMGDMAPCE---NVSIATVNSMCMEATYQKYDC 996
            :..:...|...||...::.       ||:..:.:.|...|.   |.|: |...:|......|.|.
Human   653 KFPVGRKCMISGWGNTQEGNATKPELLQKASVGIIDQKTCSVLYNFSL-TDRMICAGFLEGKVDS 716

  Fly   997 TQEEYSGAPVQC-LIPGTNQWALIGVSSWRIACGPTGVERPRMYDKIASNAAWIRETISA 1055
            .|.: ||.|:.| ..||.  :.|.|:.||.|.|..  |::|.:|.:|.....||.|.:|:
Human   717 CQGD-SGGPLACEEAPGV--FYLAGIVSWGIGCAQ--VKKPGVYTRITRLKGWILEIMSS 771

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472 12/45 (27%)
LDLa 536..571 CDD:238060 12/34 (35%)
Tryp_SPc 708..>809 CDD:304450 34/106 (32%)
TMPRSS9NP_001382442.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.