DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and CG30371

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster


Alignment Length:389 Identity:74/389 - (19%)
Similarity:119/389 - (30%) Gaps:164/389 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   689 CGVQSALFNAKQHLSLPKMSAPGDWPWLVAL---FREDIHVCDGTLITQDWVLTTEGCFQGQPRA 750
            ||     ::|...::..:.:|..::|.:.||   .:.....|.||::...::||...|.....||
  Fly   142 CG-----WSATTRIANGQQAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHCIYQVSRA 201

  Fly   751 T-WMAIVGAVRLS--AKAPWTQRRRIIGMI------KSPVEGSTAALVRLETPVSYSDHVRPICL 806
            | .:||||...|.  :.:.:.|:..|..||      ..|...:..|::...:.:.:|..|.||||
  Fly   202 TNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWSRGVGPICL 266

  Fly   807 PDALQRRLLQQPPAQRRSHVPVAERLEGQLVSQQRSRLSQENQQFFLIPSQEQQDSSTENQGDED 871
            |                   ||.                                :||...    
  Fly   267 P-------------------PVG--------------------------------TSTPFT---- 276

  Fly   872 QDEQEDHFGGESAASYMPKAEALHQELDGYPLPDHAPQVNYYSSSSTVTSSSTAARIATKAPILA 936
                                         |.|.|.......:.:..|.||               
  Fly   277 -----------------------------YDLVDVIGYGTVFFAGPTSTS--------------- 297

  Fly   937 AVPAAQEQIWTNCNTLGWSRQRDHLQRVQLKMGDMAPCE----NVSIATVNSMCMEATYQKYDCT 997
                                    ||::.|.:.....|:    ||:......||   ||. |..|
  Fly   298 ------------------------LQKINLNVVTNQDCQTEYNNVATIYTGQMC---TYD-YSGT 334

  Fly   998 QEEY----SGAPVQCLIPGTNQWALIGVSSWRIACG----PTGVERPRMYDKIASNAAWIRETI 1053
            ..:.    ||.||  ::..:.|: |:|:.|:..:|.    |.||.     .:|.|..:|||:.|
  Fly   335 GRDSCQFDSGGPV--ILRKSRQF-LVGIISYGKSCAESQYPMGVN-----TRITSYISWIRQKI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 31/112 (28%)
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 67/371 (18%)
Tryp_SPc 150..389 CDD:238113 70/373 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.