DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and CG14760

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster


Alignment Length:355 Identity:69/355 - (19%)
Similarity:104/355 - (29%) Gaps:143/355 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   643 IFDVQNDTERLNDYVRVL--DPHAPEISFIRTHC------PRRQVLYVGC--------GELRCGV 691
            ||:..|...:|....::|  .|:.|.:..:.|.|      |:..||...|        .:|:|..
  Fly    19 IFEQCNHQVKLQSGQKLLINSPYYPALYPVGTSCRYAVEAPKDHVLQFKCELQLRTLSTDLKCRT 83

  Fly   692 QSALFNAKQHLSLPKMSAPGDWPWLVALFREDIHVCDGTLITQDWVLTTEGCFQGQPRATWMAIV 756
            :...||::                                  .|.|||:...|.|..:....:.:
  Fly    84 EVFHFNSE----------------------------------GDEVLTSSEYFCGSGKFERKSFL 114

  Fly   757 GAVRLSAKAPWTQRRRIIGMIKSPVEGSTAALVRLETPVSYSDHVRPICLPDA--LQRRLLQQPP 819
                         .|.:|..|.                   |.|..|   |.|  |:.:|...|.
  Fly   115 -------------NRAVISYIS-------------------SGHSEP---PSAVKLKDKLHAVPT 144

  Fly   820 AQRRSHVPVAERLEGQLVSQQRSRLSQENQQFFLIPSQEQQDSSTENQGDEDQDEQEDH----FG 880
            ....:..|.|..:|.|                  ...:||::.....:.|||..::..|    .|
  Fly   145 TSTTTEAPQAVSIEEQ------------------DAEEEQEEEEEPEEADEDLSDEVLHVLQDVG 191

  Fly   881 GESAASYMPKAEALHQ-----------ELDGYPLPDHAPQVNYYSSSSTVTSSSTAARIATKAPI 934
            ...|.:|:  |..|:.           .||..|:         .|||.|   |:..|||.:..|.
  Fly   192 VSDALAYV--ASLLYDVEESRKSSTTIYLDKLPI---------RSSSKT---SAKRARIVSSYPT 242

  Fly   935 LAAVP--------AAQEQIWTNCNTLGWSR 956
            .|..|        ...|.....| :.||||
  Fly   243 AAPSPGHGGGRFSCLVEAFQPTC-SCGWSR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 13/100 (13%)
CG14760NP_610366.1 CUB 37..126 CDD:294042 22/154 (14%)
Tryp_SPc 281..516 CDD:238113
Tryp_SPc 281..515 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.