DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and gd

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster


Alignment Length:425 Identity:78/425 - (18%)
Similarity:146/425 - (34%) Gaps:138/425 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   621 KLVVRQTVSESLCKSLGYESVEIFDVQNDTERLNDYV------RVLDPH-------------APE 666
            ||::....:..:|...|..|:.:..:|.:..|...::      .:|||.             .|.
  Fly   108 KLLLMSANNHVICFGSGEHSIFMTQIQLEHIRKLSFIPDKKSSLLLDPEEEEVRKTDDKPPSTPH 172

  Fly   667 ISFIR---THCP-----------------RRQVLYVGCGELRC--GVQSALF------NAKQHL- 702
            |.|.:   ...|                 |.:.|:|..||.:.  |:.|.:|      :..:|. 
  Fly   173 IQFKKKPFAQAPKEICGRIDRDLDFHLSQRTESLHVAIGEPKSSDGITSPVFVDDDEDDVLEHQF 237

  Fly   703 ---------------SLPKMSAPGDWPWLVALFREDI----HVCDGTLITQDWVLTTEGCFQ-GQ 747
                           |||.::. |.||||.|::..::    ..|.|:|::...|:::..||: ..
  Fly   238 VDESEAEAIESDSADSLPSITR-GSWPWLAAIYVNNLTSLDFQCGGSLVSARVVISSAHCFKLFN 301

  Fly   748 PRATWMAIVGAVRLSAKAPWTQRRRIIGMIKSPVEG---------------STAALVRLETPVSY 797
            .|.|...::..:.......|.:.    |.:.:||:|               :..|::.|:..|.:
  Fly   302 KRYTSNEVLVFLGRHNLKNWNEE----GSLAAPVDGIYIHPDFNSQLSSYDADIAVIILKDEVRF 362

  Fly   798 SDHVRPICLPDALQRRLLQQPPAQRRSHVPVAERLEGQLV--SQQRSRLSQENQQFFLIPSQEQQ 860
            :..:||.||..           ...::...|.||  |.::  |..|:..:::.:....:|.::..
  Fly   363 NTFIRPACLWS-----------GSSKTEYIVGER--GIVIGWSFDRTNRTRDQKLSSELPGKKST 414

  Fly   861 DSSTEN------QGDEDQDEQEDHFGGESA-----ASYMPKAEALHQELDGYPLPDHAPQVNYYS 914
            |:|...      .|:.:......||...|:     |....:....||                 |
  Fly   415 DASAPKVVKAPIVGNAECFRANAHFRSLSSNRTFCAGIQAEERDTHQ-----------------S 462

  Fly   915 SSSTVTSSSTAA-------RIATKAPILAAVPAAQ 942
            .:|..|..|.|.       |...:..:.||:||.:
  Fly   463 GASIYTGISGAGLFIRRNNRWMLRGTVSAALPAVE 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 26/120 (22%)
gdNP_001259479.1 GD_N 27..124 CDD:292649 3/15 (20%)
Tryp_SPc 257..526 CDD:238113 52/276 (19%)
Tryp_SPc 258..526 CDD:214473 52/275 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.