DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Tmprss11g

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_796136.2 Gene:Tmprss11g / 320454 MGIID:2444058 Length:417 Species:Mus musculus


Alignment Length:365 Identity:67/365 - (18%)
Similarity:113/365 - (30%) Gaps:159/365 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   710 PGD---WPWLVALFREDIHVCDGTLITQDWVLTTEGCFQG--QPRATWMAIVGAVRLSAKAPWTQ 769
            |.|   |||..:|..|.||:|..:||...|::|:..||..  .|: .|....|.   :..:|.| 
Mouse   191 PADKASWPWQSSLQVEGIHLCGASLIGSQWLVTSAHCFDNYKNPK-LWTVSFGR---TLSSPLT- 250

  Fly   770 RRRIIGMI-----KSPVEGSTAALVRLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVA 829
            .|::..:|     .|.......|:|:|.:||.:|:::..:|||||                    
Mouse   251 TRKVESIIVHENYASHKHDDDIAVVKLSSPVLFSENLHRVCLPDA-------------------- 295

  Fly   830 ERLEGQLVSQQRSRLSQENQQFFLIPSQEQQDSSTENQGDEDQDEQEDHFGGESAASYMPKAEAL 894
                                                                  ....:||::..
Mouse   296 ------------------------------------------------------TFQVLPKSKVF 306

  Fly   895 HQELDGYPLPDHAPQVNYYSSSSTVTSSSTAARIATKAPILAAVPAAQEQIWTNCNTLGWSRQR- 958
                                    ||                                ||...: 
Mouse   307 ------------------------VT--------------------------------GWGALKA 315

  Fly   959 -----DHLQRVQLKMGDMAPCENVSI--ATVNS--MCMEATYQKYDCTQEEYSGAPVQCLIPGTN 1014
                 :.||.|::::.....|..|::  ..::|  :|......|.|..:.: ||.|: .:....|
Mouse   316 NGPFPNSLQEVEIEIISNDVCNQVNVYGGAISSGMICAGFLTGKLDACEGD-SGGPL-VISDNRN 378

  Fly  1015 QWALIGVSSWRIACGPTGVERPRMYDKIASNAAWIRETIS 1054
            :|.|:|:.||.|.||..  .:|.:|.::.....||:...|
Mouse   379 KWYLLGIVSWGIDCGKE--NKPGIYTRVTHYRDWIKSKTS 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 33/108 (31%)
Tmprss11gNP_796136.2 SEA 48..142 CDD:279699
Tryp_SPc 185..411 CDD:214473 64/358 (18%)
Tryp_SPc 186..414 CDD:238113 66/361 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834052
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.