DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Tmprss11b

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_795998.2 Gene:Tmprss11b / 319875 MGIID:2442893 Length:416 Species:Mus musculus


Alignment Length:460 Identity:88/460 - (19%)
Similarity:144/460 - (31%) Gaps:199/460 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   614 EGLEGDAKLVVRQTVS---ESLCKSLGYESVEIFDVQN-DTERLNDYVRVLDPHAPEISFIRTHC 674
            |.|....:.::||.:.   |||....|  |:::.::.. |.|::                |...|
Mouse   126 ENLRRRIESILRQMLENNPESLTTDPG--SLKLTEISKVDAEKI----------------INNRC 172

  Fly   675 PRRQVLYVGCGELRCGVQSALFNAKQHLSLPKMSA------------PGDWPWLVALFREDIHVC 727
            .||                           |:|||            .|:|||..:|.....|.|
Mouse   173 GRR---------------------------PRMSATYDRITGGSTAHKGEWPWQASLRVNGKHYC 210

  Fly   728 DGTLITQDWVLTTEGCFQGQPRATWMAIVGAVRLSAKAPWTQRRRIIGMIKSPVEG---STAALV 789
            ..:||.:.::||...||||......:.:....|::........:.|| :.:..|:|   ...|::
Mouse   211 GASLIGERFLLTAAHCFQGTNNPKNLTVSFGTRVTPAYMQHSVQEII-IHEDYVKGEHHDDVAVI 274

  Fly   790 RLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVAERLEGQLVSQQRSRLSQENQQFFLI 854
            :|...||:::.|..:|||::.|    ..||.            ||.:|:                
Mouse   275 KLTEKVSFNNDVHRVCLPESTQ----IFPPG------------EGVVVT---------------- 307

  Fly   855 PSQEQQDSSTENQGDEDQDEQEDHFGGESAASYMPKAEALHQELDGYPLPDHAPQVNYYSSSSTV 919
                                      |..:.||           :|                   
Mouse   308 --------------------------GWGSFSY-----------NG------------------- 316

  Fly   920 TSSSTAARIATKAPILAAVPAAQEQIWTNCNTLGWSRQRDHLQRVQLKMGDMAPC---ENVSIAT 981
                       |:|:|                         ||:..:|:.|...|   |......
Mouse   317 -----------KSPLL-------------------------LQKASIKIIDTNTCNSEEAYGGRI 345

  Fly   982 VNSM-CMEATYQKYDCTQEEYSGAPVQCLIPGTNQ-WALIGVSSWRIACGPTGVERPRMYDKIAS 1044
            |::| |........|..|.: ||.|:  :.|.:.. |.|:|:.||...||  .|.:|.:|.::.|
Mouse   346 VDTMLCAGYLEGSIDACQGD-SGGPL--VHPNSRDIWYLVGIVSWGHECG--RVNKPGVYMRVTS 405

  Fly  1045 NAAWI 1049
            ...||
Mouse   406 YRNWI 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 30/115 (26%)
Tmprss11bNP_795998.2 SEA 46..140 CDD:279699 4/13 (31%)
Tryp_SPc 184..410 CDD:214473 67/355 (19%)
Tryp_SPc 185..413 CDD:238113 69/356 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834062
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.