DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Mfrp

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001101607.1 Gene:Mfrp / 315597 RGDID:1307477 Length:590 Species:Rattus norvegicus


Alignment Length:278 Identity:63/278 - (22%)
Similarity:108/278 - (38%) Gaps:71/278 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 YRERI---NLTLR-----RSDLREAYEG------SEILALDGSEDNNNIVV---HFNMIFDPYAG 310
            ||.|:   |.:|.     :.|..|.||.      |.:....|:|..:::|.   ...:||....|
  Rat   343 YRIRLEFHNFSLEEQTECKFDYVEVYEASNSGTFSSLGRFCGAEPPSHLVSSQHQLTVIFKTDLG 407

  Fly   311 LVSSGDLLALFH-----------------EEMTQPPQQR--RHFANMTVDVASLSIKETTGLIEE 356
             :|||..||.:.                 .|..|...:|  :...::..|.|:            
  Rat   408 -ISSGGFLATYQAINTTESGCPWADLCGPREFCQSRVRRELQRICDLWKDCAN------------ 459

  Fly   357 PIMSSSPLGGHDETTEPVVTTTPAPPRRCSPLELSYCRQVGYNITTYPNL-LGHASYEQLAEDVI 420
              .|:.....|         .:|.....|.|:::..|..:.||.|.:||: :|.|:..::.:.:.
  Rat   460 --DSNDNCNSH---------LSPQLDLTCEPVQVEMCLGLSYNTTAFPNIWVGLATQMEVTDILR 513

  Fly   421 VFRELVDGECHREAYDFVCRLLQPPCDTHGSDLQPTPGQICRE---YCESFMAGCGGRLPQRFRQ 482
            .::.|....|::....|:|.||:|.|.:.|:.|.|. ..:|:|   .|:|.:|..|...|     
  Rat   514 GYKSLTSLPCYQTFRRFLCGLLEPRCTSLGTILPPC-RSVCQEAEQQCQSSLALLGIPWP----- 572

  Fly   483 FFDCERFPESTGTQSCHQ 500
             |:|.|.|.....::|.|
  Rat   573 -FNCNRLPVPASLEACSQ 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699 22/97 (23%)
CRD_FZ 384..502 CDD:143549 34/121 (28%)
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450
MfrpNP_001101607.1 CUB 150..258 CDD:238001
LDLa 266..300 CDD:238060
CUB 307..419 CDD:238001 21/76 (28%)
Fz 477..579 CDD:279700 31/108 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.