DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Prss30

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:409 Identity:84/409 - (20%)
Similarity:124/409 - (30%) Gaps:181/409 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   676 RRQVLYVGCGELR-----CGVQSALFNAKQHLSLPKMSAPGDWPWLVALF-REDIHVCDGTLITQ 734
            |..:|...||..|     .|.|.||              .|.|||.|:|: .||.|:|.|:||.:
Mouse    57 RGDILPSVCGHSRDAGKIVGGQDAL--------------EGQWPWQVSLWITEDGHICGGSLIHE 107

  Fly   735 DWVLTTEGCFQGQPRATWMAI-VGAVRLSAKAPWTQRRRIIGMIKSP------VEGSTAALVRLE 792
            .||||...||:.....::..: ||.:.||...|.:....:..:...|      ......|||:|:
Mouse   108 VWVLTAAHCFRRSLNPSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLD 172

  Fly   793 TPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVAERLEGQLVSQQRSRLSQENQQFFLIPSQ 857
            ||:..|... |:|||.|       |.|                                 |.|. 
Mouse   173 TPLRPSQFT-PVCLPAA-------QTP---------------------------------LTPG- 195

  Fly   858 EQQDSSTENQGDEDQDEQEDHFGGESAASYMPKAEALHQELDGYPLPDHAPQVNYYSSSSTVTSS 922
                                                                             
Mouse   196 ----------------------------------------------------------------- 195

  Fly   923 STAARIATKAPILAAVPAAQEQIWTNCNTLGW--SRQRDH---LQRVQLKMGDMAPCENVSIATV 982
                                    |.|...||  :::||.   ||.:.:.:.|...||.:.....
Mouse   196 ------------------------TVCWVTGWGATQERDMASVLQELAVPLLDSEDCEKMYHTQG 236

  Fly   983 NSMCME---------ATY---QKYDCTQEEYSGAPVQCLIPGTNQWALIGVSSWRIACGPTGVER 1035
            :|:..|         |.|   ||..|..:  ||.|:.|.|  .:.|..:|::||.|.|...  .|
Mouse   237 SSLSGERIIQSDMLCAGYVEGQKDSCQGD--SGGPLVCSI--NSSWTQVGITSWGIGCARP--YR 295

  Fly  1036 PRMYDKIASNAAWIRETIS 1054
            |.:|.::.:...||:..::
Mouse   296 PGVYTRVPTYVDWIQRILA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 36/108 (33%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 79/388 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834056
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.