DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and fzd2

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_571215.1 Gene:fzd2 / 30370 ZFINID:ZDB-GENE-990415-224 Length:550 Species:Danio rerio


Alignment Length:113 Identity:36/113 - (31%)
Similarity:48/113 - (42%) Gaps:16/113 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 CSPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPCDTH 449
            |.|:.:..|..:.||.|..|||:||.:.|....:|..|..||..:|..|...|:|.:..|.|...
Zfish    39 CQPITIPLCTDIAYNQTIMPNLVGHYNQEDAGLEVHQFYPLVKVQCSPELKFFLCSMYAPVCTVL 103

  Fly   450 GSDLQPTPGQICREYCESFMAGC-------GGRLPQRFRQFFDCERFP 490
            ...:.|     ||..||....||       |.:.|:..|    ||.||
Zfish   104 EKAIPP-----CRSICERAKQGCEVLMNKFGFQWPEALR----CEHFP 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 36/113 (32%)
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450
fzd2NP_571215.1 CRD_FZ1_like 37..154 CDD:143567 36/113 (32%)
7tmF_FZD2 219..548 CDD:320373
TM helix 1 228..253 CDD:320373
TM helix 2 262..283 CDD:320373
TM helix 3 313..339 CDD:320373
TM helix 4 356..372 CDD:320373
TM helix 5 394..423 CDD:320373
TM helix 6 443..470 CDD:320373
TM helix 7 499..524 CDD:320373
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.