DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Frzb

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001093997.1 Gene:Frzb / 295691 RGDID:1311315 Length:323 Species:Rattus norvegicus


Alignment Length:408 Identity:75/408 - (18%)
Similarity:132/408 - (32%) Gaps:142/408 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 CSPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPCDTH 449
            |.|:.:..|:.:.:|:|..||.|.|::.......:..|..|:...|..:...|:|.:..|.|.. 
  Rat    35 CEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTI- 98

  Fly   450 GSDLQPTPGQICREYCESFMAGCGGRLPQRFRQFFDCERFPESTGTQSCHQKPHCVSDMQSNVQS 514
              |.|..|.:.|:..||....||...| .::|     ..:|||.   :|.:.|            
  Rat    99 --DFQHEPIKPCKSVCERARQGCEPIL-IKYR-----HSWPESL---ACEELP------------ 140

  Fly   515 PRLCDGYADCPDLSDERSCAFCSPNALYCGRGRACVPRKARCDGKADCPDGADEKDCLSIAPLAA 579
                        :.|...|  .||.|:...                   ||||       .|:.:
  Rat   141 ------------VYDRGVC--ISPEAIVTA-------------------DGAD-------FPMDS 165

  Fly   580 DLLQPEPLVPYLSRFHSAGYAVFSEKGVVGKLCAEGLEGDAKLVVRQTVSESLCKSLGYESVEIF 644
                            |.|:.                        |.|.||. ||.....:.:  
  Rat   166 ----------------STGHC------------------------RGTSSER-CKCKPVRATQ-- 187

  Fly   645 DVQNDTERLNDYVRVLDPHAPEISFIRTHCPRRQVLYVGCGELRCGVQSALFNAKQHLSLPKMSA 709
                .|...|:|..|:.....|:                  :::|...:|:...|:.|....::.
  Rat   188 ----KTYFRNNYNYVIRAKVKEV------------------KMKCHDVTAIVEVKEILKASLVNI 230

  Fly   710 PGDWPWLVALFREDIHVCDGTLITQDWVLTTEGCFQGQPRATWMAIVGAV------RLSAKAP-W 767
            |.|   .|.|:.....:|....:.:::|:..   ::.:.|:..:.:.|::      ||..|.. |
  Rat   231 PRD---TVNLYSTSGCLCPPLSVNEEYVIMG---YEDEERSRLLLVEGSIAEKWKDRLGKKVKRW 289

  Fly   768 TQRRRIIGMIKSPVEGST 785
            ..:.|.:|:.|:....||
  Rat   290 DMKLRHLGLGKTDASDST 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 30/116 (26%)
PRKCSH-like <503..>582 CDD:193472 10/78 (13%)
LDLa 536..571 CDD:238060 7/34 (21%)
Tryp_SPc 708..>809 CDD:304450 17/85 (20%)
FrzbNP_001093997.1 CRD_SFRP3 32..157 CDD:143550 36/178 (20%)
NTR_Sfrp3_like 188..297 CDD:239636 22/132 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.