DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and TMPRSS11E

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_054777.2 Gene:TMPRSS11E / 28983 HGNCID:24465 Length:423 Species:Homo sapiens


Alignment Length:418 Identity:85/418 - (20%)
Similarity:123/418 - (29%) Gaps:163/418 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   651 ERLNDYV--RVLDPHAPEISFIR--------THCPRRQVLYVGCGELRCGVQSALFNAKQHLSLP 705
            |:|.|.|  ..:|||:.:|..|.        .||         ||..|    |........:...
Human   144 EKLQDAVGPPKVDPHSVKIKKINKTETDSYLNHC---------CGTRR----SKTLGQSLRIVGG 195

  Fly   706 KMSAPGDWPWLVALFREDIHVCDGTLITQDWVLTTEGCFQGQPR-ATWMAIVGAVRLSAKAPWTQ 769
            .....|:|||..:|..:..|.|..|||...|:::...||..... |.|.|..|.....:|.....
Human   196 TEVEEGEWPWQASLQWDGSHRCGATLINATWLVSAAHCFTTYKNPARWTASFGVTIKPSKMKRGL 260

  Fly   770 RRRII-GMIKSPVEGSTAALVRLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVAERLE 833
            ||.|: ...|.|......:|..|.:||.|::.|..:|||||                        
Human   261 RRIIVHEKYKHPSHDYDISLAELSSPVPYTNAVHRVCLPDA------------------------ 301

  Fly   834 GQLVSQQRSRLSQENQQFFLIPSQEQQDSSTENQGDEDQDEQEDHFGGESAASYMPKAEALHQEL 898
                                  |.|.|      .||               ..::....||..  
Human   302 ----------------------SYEFQ------PGD---------------VMFVTGFGALKN-- 321

  Fly   899 DGYPLPDHAPQVNYYSSSSTVTSSSTAARIATKAPILAAVPAAQEQIWTNCNTLGWSRQRDHLQR 963
            |||                                                       .::||::
Human   322 DGY-------------------------------------------------------SQNHLRQ 331

  Fly   964 VQLKMGDMAPCE-----NVSIATVNSMCMEATYQKYDCTQEEYSGAPVQCLIPGTNQ--WALIGV 1021
            .|:.:.|...|.     |.:| |...:|..:...|.|..|.: ||.|   |:....:  |.|.|:
Human   332 AQVTLIDATTCNEPQAYNDAI-TPRMLCAGSLEGKTDACQGD-SGGP---LVSSDARDIWYLAGI 391

  Fly  1022 SSWRIACGPTGVERPRMYDKIASNAAWI 1049
            .||...|...  .:|.:|.::.:...||
Human   392 VSWGDECAKP--NKPGVYTRVTALRDWI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 32/102 (31%)
TMPRSS11ENP_054777.2 SEA 51..156 CDD:307516 4/11 (36%)
Tryp_SPc 192..420 CDD:238113 70/357 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143781
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.