DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Prss30

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:404 Identity:73/404 - (18%)
Similarity:118/404 - (29%) Gaps:177/404 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   676 RRQVLYVGCGELRCGVQSALFNAKQHLSLPKMSAP-GDWPWLVALFRE-DIHVCDGTLITQDWVL 738
            |..:|:.|.|::..|                ..|| |.|||.|:|..| :.|:|.|:||.:.|||
  Rat    20 RGDILHSGAGKIVGG----------------QDAPEGRWPWQVSLRTEKEGHICGGSLIHEVWVL 68

  Fly   739 TTEGCFQGQPRATWMAI-VGAVRLSAKAPWTQRRRIIGMIKSP------VEGSTAALVRLETPVS 796
            |...||.....:::..: ||.:.||...|.:....:..:...|      ......||:||:||:.
  Rat    69 TAAHCFCRPLNSSFYHVKVGGLTLSLTEPHSTLVAVRNIFVYPTYLWEDASSGDIALLRLDTPLQ 133

  Fly   797 YSDHVRPICLPDALQRRLLQQPPAQRRSHVPVAERLEGQLVSQQRSRLSQENQQFFLIPSQEQQD 861
            .| ...|:|||.|                                                    
  Rat   134 PS-QFSPVCLPQA---------------------------------------------------- 145

  Fly   862 SSTENQGDEDQDEQEDHFGGESAASYMPKAEALHQELDGYPLPDHAPQVNYYSSSSTVTSSSTAA 926
                                                                             
  Rat   146 ----------------------------------------------------------------- 145

  Fly   927 RIATKAPILAAVPAAQEQIWTNCNTLGWSRQRDH-----LQRVQLKMGDMAPCENV--------- 977
                :||:...         |.|...||....:.     ||.:.:.:.|...||.:         
  Rat   146 ----QAPLTPG---------TVCWVTGWGATHERELASVLQELAVPLLDSEDCERMYHIGETSLS 197

  Fly   978 --SIATVNSMCMEATYQKYDCTQEEYSGAPVQCLIPGTNQWALIGVSSWRIACGPTGVERPRMYD 1040
              .:...:.:|......:.|..|.: ||.|:.|.|  .:.|..:|::||.|.|...  .:|.:|.
  Rat   198 GKRVIQSDMLCAGFVEGQKDSCQGD-SGGPLVCAI--NSSWIQVGITSWGIGCARP--NKPGVYT 257

  Fly  1041 KIASNAAWIRETIS 1054
            ::.....||:.|::
  Rat   258 RVPDYVDWIQRTLA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 37/109 (34%)
Prss30NP_955403.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.