DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Sp212

DIOPT Version :10

Sequence 1:NP_572467.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:146 Identity:37/146 - (25%)
Similarity:66/146 - (45%) Gaps:25/146 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   675 PRRQVLYVGCGELRCGVQSALFNAKQHLSLPKMSAPGDWPWLVALFREDIHV----CDGTLITQD 735
            ||.|:..|.||  |.| .:..|..:.: ..|:    |.:|||.|::.:::..    |.|:||:..
  Fly   258 PRSQISSVVCG--REG-STTPFIVRGN-EFPR----GQYPWLSAVYHKEVRALAFKCRGSLISSS 314

  Fly   736 WVLTTEGCFQGQPRATW-MAIVGAVRLSAK---APWTQRRRIIGMIKSP------VEGSTAALVR 790
            .|::...|..   |.|. ..:||..|....   ....:.|.::.::..|      ...:..||:.
  Fly   315 IVISAAHCVH---RMTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALIT 376

  Fly   791 LETPVSYSDHVRPICL 806
            :|.||:::|.:.|||:
  Fly   377 IERPVTFNDIIAPICM 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_572467.1 SEA 232..>309 CDD:460188
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:372423
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:473915 27/113 (24%)
Sp212NP_996209.2 GD_N 23..127 CDD:464985
Tryp_SPc 277..514 CDD:238113 28/124 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.