DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Sp212

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:146 Identity:37/146 - (25%)
Similarity:66/146 - (45%) Gaps:25/146 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   675 PRRQVLYVGCGELRCGVQSALFNAKQHLSLPKMSAPGDWPWLVALFREDIHV----CDGTLITQD 735
            ||.|:..|.||  |.| .:..|..:.: ..|:    |.:|||.|::.:::..    |.|:||:..
  Fly   258 PRSQISSVVCG--REG-STTPFIVRGN-EFPR----GQYPWLSAVYHKEVRALAFKCRGSLISSS 314

  Fly   736 WVLTTEGCFQGQPRATW-MAIVGAVRLSAK---APWTQRRRIIGMIKSP------VEGSTAALVR 790
            .|::...|..   |.|. ..:||..|....   ....:.|.::.::..|      ...:..||:.
  Fly   315 IVISAAHCVH---RMTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALIT 376

  Fly   791 LETPVSYSDHVRPICL 806
            :|.||:::|.:.|||:
  Fly   377 IERPVTFNDIIAPICM 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 27/113 (24%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 28/124 (23%)
Tryp_SPc 277..511 CDD:214473 28/124 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.