DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Tmprss5

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:598 Identity:118/598 - (19%)
Similarity:179/598 - (29%) Gaps:223/598 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   505 VSDMQSNV-QSPRLCDGYADCPDLSDERSCAFCSPNALYCGRG------------RACVPRKARC 556
            :.|.|..: ||.|.|     |.    :|.|.......|..|.|            .|..|.....
  Rat    19 LGDQQQPISQSQRWC-----CL----QRGCVILGALGLLAGAGVGSWLLVLYLWPAASPPVSVTL 74

  Fly   557 DGK---ADCPDGADEKDCLSIAPLAADLLQPEPLVPYLSRFHSAGYAVFSEKGVVGK-----LCA 613
            ..:   ..||..:.|:..|             |.:|....|...|..:..|..|..:     :|.
  Rat    75 QEEEVTLSCPGVSSEEKLL-------------PSLPKAVSFRINGEDLLLEVQVRARPDWLLVCH 126

  Fly   614 EGLEGDAKLVVRQTVSESLCKSLGY------ESVEIFDVQNDTERLNDYVRVLDPHAPEISFIR- 671
            ||.        ...:...:|:||||      ::|.:.|:     :||.........|...|.:. 
  Rat   127 EGW--------NPALGMHICQSLGYFRLTQHKAVNLSDI-----KLNRSQEFAQLSARPGSLVEE 178

  Fly   672 -----THCPRRQVLYVGCGELRCGVQSALFNAKQHLSLPKMS--------APGDWPWLVALFRED 723
                 |:||..:::.:.|.|  ||.:            |..|        |.|.|||..::....
  Rat   179 AWQPSTNCPSGRIVSLKCSE--CGAR------------PLASRIVGGQAVASGRWPWQASVMLGS 229

  Fly   724 IHVCDGTLITQDWVLTTEGC---FQGQPRATWMAIVGAVRLSAKAPWTQRRRIIGMIKSPVEGS- 784
            .|.|..:::...||:|...|   |:....::|....|.|..|| ....|...:..:|..|:..: 
  Rat   230 RHTCGASVLAPYWVVTAAHCMYSFRLSRLSSWRVHAGLVSHSA-VRQHQGTMVEKIIPHPLYSAQ 293

  Fly   785 ----TAALVRLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVAERLEGQLVSQQRSRLS 845
                ..||::|.||:::||.|..:|||                                      
  Rat   294 NHDYDVALLQLRTPINFSDTVSAVCLP-------------------------------------- 320

  Fly   846 QENQQFFLIPSQEQQDSSTENQGDEDQDEQEDHFGGESAASYMPKAEALHQELDGYPLPDHAPQV 910
                                        .:|.||         |:.........|:..|.|.   
  Rat   321 ----------------------------AKEQHF---------PQGSQCWVSGWGHTDPSHT--- 345

  Fly   911 NYYSSSSTVTSSSTAARIATKAPILAAVPAAQEQIWTNCNTLGWSRQRDHLQRVQLKMGDMAPCE 975
               .||.|:..        |..|:|:.         ..||                     :.|.
  Rat   346 ---HSSDTLQD--------TMVPLLST---------DLCN---------------------SSCM 369

  Fly   976 NVSIATVNSMCMEATYQKYDCTQEEYSGAPVQCLIPGTNQWALIGVSSWRIACGPTGVERPRMYD 1040
            .....|...:|......:.|..|.: ||.|:.|  |..:.|.|:||.||...|...  .||.:|.
  Rat   370 YSGALTHRMLCAGYLDGRADACQGD-SGGPLVC--PSGDTWHLVGVVSWGRGCAEP--NRPGVYA 429

  Fly  1041 KIASNAAWIRETI 1053
            |:|....||.:|:
  Rat   430 KVAEFLDWIHDTV 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472 18/92 (20%)
LDLa 536..571 CDD:238060 8/49 (16%)
Tryp_SPc 708..>809 CDD:304450 32/116 (28%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055 24/123 (20%)
Tryp_SPc 208..441 CDD:238113 70/357 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337603
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.