| Sequence 1: | NP_001245577.1 | Gene: | CG1632 / 31763 | FlyBaseID: | FBgn0030027 | Length: | 1056 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001457.1 | Gene: | FZD2 / 2535 | HGNCID: | 4040 | Length: | 565 | Species: | Homo sapiens |
| Alignment Length: | 233 | Identity: | 63/233 - (27%) |
|---|---|---|---|
| Similarity: | 79/233 - (33%) | Gaps: | 55/233 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 385 CSPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPCDTH 449
Fly 450 GSDLQPTPGQICREYCESFMAGC-------GGRLPQRFRQFFDCERFPESTGTQSCHQKPHC--- 504
Fly 505 VSDMQSNVQSPRLCDGYADCPDLSDERSCAFCSPNALYCGRGRACVPRKARCDGKADCP------ 563
Fly 564 -----DGADEKDCLSIAPLAADLLQPEPLVPYLSRFHS 596 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1632 | NP_001245577.1 | SEA | 232..327 | CDD:279699 | |
| CRD_FZ | 384..502 | CDD:143549 | 40/123 (33%) | ||
| PRKCSH-like | <503..>582 | CDD:193472 | 17/92 (18%) | ||
| LDLa | 536..571 | CDD:238060 | 8/45 (18%) | ||
| Tryp_SPc | 708..>809 | CDD:304450 | |||
| FZD2 | NP_001457.1 | CRD_FZ2 | 35..161 | CDD:143573 | 41/130 (32%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 160..189 | 6/44 (14%) | |||
| 7tmF_FZD2 | 234..563 | CDD:320373 | 2/4 (50%) | ||
| TM helix 1 | 244..268 | CDD:320373 | |||
| TM helix 2 | 277..298 | CDD:320373 | |||
| TM helix 3 | 328..350 | CDD:320373 | |||
| TM helix 4 | 371..387 | CDD:320373 | |||
| TM helix 5 | 409..432 | CDD:320373 | |||
| TM helix 6 | 463..485 | CDD:320373 | |||
| TM helix 7 | 514..539 | CDD:320373 | |||
| Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 | 543..548 | ||||
| PDZ-binding | 563..565 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||