| Sequence 1: | NP_001245577.1 | Gene: | CG1632 / 31763 | FlyBaseID: | FBgn0030027 | Length: | 1056 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_036939.1 | Gene: | Smo / 25273 | RGDID: | 3726 | Length: | 793 | Species: | Rattus norvegicus |
| Alignment Length: | 201 | Identity: | 46/201 - (22%) |
|---|---|---|---|
| Similarity: | 72/201 - (35%) | Gaps: | 45/201 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 365 GGHDETTEPVVTTTPAPP--------RRCSPLELSYC--RQVGYNITTYPNLLGHA-SYEQLAED 418
Fly 419 VIVFRELVDG-ECHREAYDFVCRLLQPPCDTHGSDLQPTPGQICREYCESFMAGCGGRLPQRFR- 481
Fly 482 --QFFDC--ERFPESTGTQSCHQKPHCVSDMQS-NVQSPRLCDG---YADCPD--LSDERSCAFC 536
Fly 537 SPNALY 542 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1632 | NP_001245577.1 | SEA | 232..327 | CDD:279699 | |
| CRD_FZ | 384..502 | CDD:143549 | 28/126 (22%) | ||
| PRKCSH-like | <503..>582 | CDD:193472 | 10/46 (22%) | ||
| LDLa | 536..571 | CDD:238060 | 2/7 (29%) | ||
| Tryp_SPc | 708..>809 | CDD:304450 | |||
| Smo | NP_036939.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 35..61 | 5/14 (36%) | |
| CRD_SMO | 70..200 | CDD:143560 | 32/149 (21%) | ||
| Frizzled | 225..554 | CDD:279827 | 1/2 (50%) | ||
| Interaction with BBS5 and BBS7. /evidence=ECO:0000250|UniProtKB:P56726 | 542..573 | ||||
| Interaction with DLG5. /evidence=ECO:0000250|UniProtKB:P56726 | 585..597 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 674..702 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||