DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and FRZB

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001454.2 Gene:FRZB / 2487 HGNCID:3959 Length:325 Species:Homo sapiens


Alignment Length:407 Identity:70/407 - (17%)
Similarity:126/407 - (30%) Gaps:142/407 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 CSPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPCDTH 449
            |.|:.:..|:.:.:|:|..||.|.|::.......:..|..|:...|..:...|:|.:..|.|.. 
Human    35 CEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTI- 98

  Fly   450 GSDLQPTPGQICREYCESFMAGCGGRLPQRFRQFFDCERFPESTGTQSCHQKPHCVSDMQSNVQS 514
              |.|..|.:.|:..||....||...| .::|     ..:||:.   :|.:.|            
Human    99 --DFQHEPIKPCKSVCERARQGCEPIL-IKYR-----HSWPENL---ACEELP------------ 140

  Fly   515 PRLCDGYADCPDLSDERSCAFCSPNALYCGRGRACVPRKARCDGKADCPDGADEKDCLSIAPLAA 579
                        :.|...|  .||.|:....|             ||.|..:...:|        
Human   141 ------------VYDRGVC--ISPEAIVTADG-------------ADFPMDSSNGNC-------- 170

  Fly   580 DLLQPEPLVPYLSRFHSAGYAVFSEKGVVGKLCAEGLEGDAKLVVRQTVSESLCKSLGYESVEIF 644
                                     :|...:.|.                   ||.:.......|
Human   171 -------------------------RGASSERCK-------------------CKPIRATQKTYF 191

  Fly   645 DVQNDTERLNDYVRVLDPHAPEISFIRTHCPRRQVLYVGCGELRCGVQSALFNAKQHLSLPKMSA 709
                    .|:|..|:.....||                  :.:|...:|:...|:.|....::.
Human   192 --------RNNYNYVIRAKVKEI------------------KTKCHDVTAVVEVKEILKSSLVNI 230

  Fly   710 PGDWPWLVALFREDIHVCDGTLITQDWVLTTEGCFQGQPRATWMAIVGAV------RLSAKAP-W 767
            |.|   .|.|:.....:|....:.:::::..   ::.:.|:..:.:.|::      ||..|.. |
Human   231 PRD---TVNLYTSSGCLCPPLNVNEEYIIMG---YEDEERSRLLLVEGSIAEKWKDRLGKKVKRW 289

  Fly   768 TQRRRIIGMIKSPVEGS 784
            ..:.|.:|:.||....|
Human   290 DMKLRHLGLSKSDSSNS 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 29/116 (25%)
PRKCSH-like <503..>582 CDD:193472 10/78 (13%)
LDLa 536..571 CDD:238060 7/34 (21%)
Tryp_SPc 708..>809 CDD:304450 16/84 (19%)
FRZBNP_001454.2 CRD_SFRP3 32..157 CDD:143550 35/159 (22%)
NTR_Sfrp3_like 188..297 CDD:239636 22/140 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..325 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.