DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Tmprss11e

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_766468.1 Gene:Tmprss11e / 243084 MGIID:3513175 Length:423 Species:Mus musculus


Alignment Length:346 Identity:70/346 - (20%)
Similarity:103/346 - (29%) Gaps:138/346 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   712 DWPWLVALFREDIHVCDGTLITQDWVLTTEGCFQ-GQPRATWMAIVGAVRLSAKAPWTQRRRII- 774
            :|||..:|..:..|.|..|||...|::|...||: .:..:.|.|..||. |..:...|..|||| 
Mouse   202 EWPWQSSLRWDGSHRCGATLINNTWLVTAAHCFRTHKDPSRWSATFGAT-LQPRKLTTGIRRIIV 265

  Fly   775 -GMIKSPVEGSTAALVRLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVAERLEGQLVS 838
             ...|.|......||..|..||..::.|..:|||||                             
Mouse   266 HEKYKYPSHDYDIALAELSKPVPCTNAVHKVCLPDA----------------------------- 301

  Fly   839 QQRSRLSQENQQFFLIPSQEQQDSSTENQGDEDQDEQEDHFGGESAASYMPKAEALHQELDGYPL 903
               :...|..|:.|:                       ..||            ||..  ||:  
Mouse   302 ---NHEFQPGQRMFV-----------------------TGFG------------ALKN--DGF-- 324

  Fly   904 PDHAPQVNYYSSSSTVTSSSTAARIATKAPILAAVPAAQEQIWTNCNTLGWSRQRDHLQRVQLKM 968
                                                                 .:::|::||:..
Mouse   325 -----------------------------------------------------TQNNLRQVQVDY 336

  Fly   969 GDMAPCE-----NVSIATVNSMCMEATYQKYDCTQEEYSGAPVQCLIPGTNQWALIGVSSWRIAC 1028
            .|...|.     |.:| |...:|......:.|..|.:..|..|...:  .:.|.|.||.||...|
Mouse   337 IDTQTCNQPQSYNGAI-TPRMLCAGFLKGEKDACQGDSGGPLVTADV--RDIWYLAGVVSWGDEC 398

  Fly  1029 GPTGVERPRMYDKIASNAAWI 1049
            |..  .:|.:|.::.:...||
Mouse   399 GQP--NKPGVYTRVTAFRHWI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 34/99 (34%)
Tmprss11eNP_766468.1 SEA 50..145 CDD:279699
Tryp_SPc 191..417 CDD:214473 68/344 (20%)
Tryp_SPc 192..420 CDD:238113 70/346 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834009
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.