DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Tmprss11d

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_663536.1 Gene:Tmprss11d / 231382 MGIID:2385221 Length:417 Species:Mus musculus


Alignment Length:372 Identity:74/372 - (19%)
Similarity:119/372 - (31%) Gaps:139/372 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   689 CGVQSALFNAKQHLSLPKMSA-PGDWPWLVALFREDIHVCDGTLITQDWVLTTEGCFQGQPRAT- 751
            ||.:..|....:...:..|.| ||||||.|:|...::|.|.|.||:..||||...||:..|... 
Mouse   172 CGARPDLITLSEERIIGGMQAEPGDWPWQVSLQLNNVHHCGGALISNMWVLTAAHCFKSYPNPQY 236

  Fly   752 WMAIVGAVRLSAKAPWTQRRRIIGMI-----KSPVEGSTAALVRLETPVSYSDHVRPICLPDALQ 811
            |.|..|...:|.:.    |.|:..::     .|....:..|:|:|:..|::|.::..:|||.|.|
Mouse   237 WTATFGVSTMSPRL----RVRVRAILAHDGYSSVTRDNDIAVVQLDRSVAFSRNIHRVCLPAATQ 297

  Fly   812 RRLLQQPPAQRRSHVPVAERLEGQLVSQQRSRLSQENQQFFLIPSQEQQDSSTENQGDEDQDEQE 876
            .                                        :||.                    
Mouse   298 N----------------------------------------IIPG-------------------- 302

  Fly   877 DHFGGESAASYMPKAEALHQELDGYPLPDHAPQVNYYSSSSTVTSSSTAARIATKAPILAAVPAA 941
                                            .|.|.:...::|....|.....:..:  .:.::
Mouse   303 --------------------------------SVAYVTGWGSLTYGGNAVTNLRQGEV--RIISS 333

  Fly   942 QEQIWTNCNT-LGWSRQRDHLQRVQLKMGDMAPCENVSIATVNSMCMEATYQKYDCTQEEYSGAP 1005
            :|     ||| .|:|             |.:.|         ..:|........|..|.:..|..
Mouse   334 EE-----CNTPAGYS-------------GSVLP---------GMLCAGMRSGAVDACQGDSGGPL 371

  Fly  1006 VQCLIPGTNQWALIGVSSWRIACG-PTGVERPRMYDKIASNAAWIRE 1051
            ||  ......|.::|:.||...|| |   .:|.:|.::.:...|||:
Mouse   372 VQ--EDSRRLWFVVGIVSWGYQCGLP---NKPGVYTRVTAYRNWIRQ 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 36/107 (34%)
Tmprss11dNP_663536.1 SEA 48..140 CDD:279699
Tryp_SPc 185..411 CDD:214473 68/355 (19%)
Tryp_SPc 186..414 CDD:238113 71/358 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834060
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.