DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Sfrp1

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_038862.2 Gene:Sfrp1 / 20377 MGIID:892014 Length:314 Species:Mus musculus


Alignment Length:164 Identity:42/164 - (25%)
Similarity:61/164 - (37%) Gaps:42/164 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 PRRC--SPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQP 444
            |.:|  .|::|..|..|||.....||||.|.:..::.:....:..|::..||.....|:|.|..|
Mouse    55 PPQCVDIPVDLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHMGTQVFLCSLFAP 119

  Fly   445 PCDTHGSDLQPTPGQICREYCESFMAGCGGRLPQRFRQFF--------DCERFPES--------- 492
            .|       ...|...||..||:....|     :...|||        .|::|||.         
Mouse   120 VC-------LDRPIYPCRWLCEAVRDSC-----EPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPP 172

  Fly   493 --------TGTQSCHQKPHCVSDMQSNVQSPRLC 518
                    .||..|   |.|.::::|......||
Mouse   173 NTTEASKPQGTTVC---PPCDNELKSEAIIEHLC 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 36/144 (25%)
PRKCSH-like <503..>582 CDD:193472 4/16 (25%)
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450
Sfrp1NP_038862.2 CRD_SFRP1 52..175 CDD:143552 34/131 (26%)
NTR_Sfrp1_like 183..306 CDD:239635 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.