Sequence 1: | NP_001245577.1 | Gene: | CG1632 / 31763 | FlyBaseID: | FBgn0030027 | Length: | 1056 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032084.2 | Gene: | Fzd8 / 14370 | MGIID: | 108460 | Length: | 685 | Species: | Mus musculus |
Alignment Length: | 244 | Identity: | 59/244 - (24%) |
---|---|---|---|
Similarity: | 83/244 - (34%) | Gaps: | 74/244 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 385 CSPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPC-DT 448
Fly 449 HGSDLQPTPGQICREYCESFMAGC-------GGRLPQRFRQFFDCERFPESTGTQSCHQKPHCVS 506
Fly 507 DMQSNVQSPRLCDGYADCPDLSDERSCAFCSPNAL------------------------------ 541
Fly 542 YCGRGRACVPRKARCDGKADCPDGAD---EKDCLSIAPLAADLLQPEPL 587 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1632 | NP_001245577.1 | SEA | 232..327 | CDD:279699 | |
CRD_FZ | 384..502 | CDD:143549 | 35/124 (28%) | ||
PRKCSH-like | <503..>582 | CDD:193472 | 22/111 (20%) | ||
LDLa | 536..571 | CDD:238060 | 12/67 (18%) | ||
Tryp_SPc | 708..>809 | CDD:304450 | |||
Fzd8 | NP_032084.2 | CRD_FZ8 | 31..155 | CDD:143570 | 40/151 (26%) |
Palmitate-binding groove | 71..78 | 3/6 (50%) | |||
Wnt-binding | 95..100 | 1/4 (25%) | |||
Wnt-binding | 147..152 | 3/8 (38%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 155..223 | 13/68 (19%) | |||
7tmF_FZD8 | 264..616 | CDD:320378 | |||
TM helix 1 | 273..298 | CDD:320378 | |||
TM helix 2 | 307..328 | CDD:320378 | |||
TM helix 3 | 395..417 | CDD:320378 | |||
TM helix 4 | 438..454 | CDD:320378 | |||
TM helix 5 | 476..499 | CDD:320378 | |||
TM helix 6 | 529..554 | CDD:320378 | |||
TM helix 7 | 577..602 | CDD:320378 | |||
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 | 606..611 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 631..656 | ||||
PDZ-binding | 683..685 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |