DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Fzd5

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001036124.1 Gene:Fzd5 / 14367 MGIID:108571 Length:585 Species:Mus musculus


Alignment Length:220 Identity:56/220 - (25%)
Similarity:74/220 - (33%) Gaps:57/220 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 CSPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPC--D 447
            |..:.:..||.:|||:|..||...|.:.::...:|..|..||:..|..:...|:|.:..|.|  |
Mouse    33 CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPD 97

  Fly   448 THGSDLQPTPGQICREYCESFMAGC-------GGRLPQRFRQFFDCERFPESTGTQSCHQKPHCV 505
            .|    :|.|.  ||..||...|||       |...|:|    ..|:|.|...|           
Mouse    98 YH----KPLPP--CRSVCERAKAGCSPLMRQYGFAWPER----MSCDRLPVLGG----------- 141

  Fly   506 SDMQSNVQSPRLCDGYADCPDLSDERSCAFCSPNALYCGRGRACVPRKARCDGKADCPDGADEKD 570
                   .:..||..|       :.......||.:.         |.|....|....|....|  
Mouse   142 -------DAEVLCMDY-------NRSEATTASPKSF---------PAKPTLPGPPGAPSSGGE-- 181

  Fly   571 CLSIAPLAADLLQPEPLVPYLSRFH 595
            |.|..|.....  .||.||.|...|
Mouse   182 CPSGGPSVCTC--REPFVPILKESH 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 37/125 (30%)
PRKCSH-like <503..>582 CDD:193472 13/78 (17%)
LDLa 536..571 CDD:238060 7/34 (21%)
Tryp_SPc 708..>809 CDD:304450
Fzd5NP_001036124.1 CRD_FZ5 29..156 CDD:143569 40/157 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 156..182 7/36 (19%)
7tm_GPCRs 225..535 CDD:333717
TM helix 1 235..259 CDD:320095
TM helix 2 268..289 CDD:320095
TM helix 3 316..338 CDD:320095
TM helix 4 359..375 CDD:320095
TM helix 5 397..420 CDD:320095
TM helix 6 448..473 CDD:320095
TM helix 7 496..521 CDD:320095
PDZ-binding. /evidence=ECO:0000250 582..584
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.