DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Fzd4

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_032081.3 Gene:Fzd4 / 14366 MGIID:108520 Length:537 Species:Mus musculus


Alignment Length:156 Identity:39/156 - (25%)
Similarity:66/156 - (42%) Gaps:20/156 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 GLIEEPIMSSSPLGGHDETTEPVVTTTPAPPRRCSPLELSYCRQVGYNITTYPNLLGHASYEQLA 416
            ||:.:.::...|..|..:..|          |||.|:.::.|:.:|||:|..|||:||.......
Mouse    22 GLLLQFLLLLRPTLGFGDEEE----------RRCDPIRIAMCQNLGYNVTKMPNLVGHELQTDAE 76

  Fly   417 EDVIVFRELVDGECHREAYDFVCRLLQPPCDTHGSDLQPTP-GQIC---REYCESFMAGCGGRLP 477
            ..:..|..|:...|..:...|:|.:..|.| |...::...| |.:|   :..||..:...|...|
Mouse    77 LQLTTFTPLIQYGCSSQLQFFLCSVYVPMC-TEKINIPIGPCGGMCLSVKRRCEPVLREFGFAWP 140

  Fly   478 QRFRQFFDCERF-PESTGTQSCHQKP 502
            ..    .:|.:| |::.....|.:.|
Mouse   141 DT----LNCSKFPPQNDHNHMCMEGP 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 32/122 (26%)
PRKCSH-like <503..>582 CDD:193472 39/156 (25%)
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450
Fzd4NP_032081.3 CRD_FZ4 42..167 CDD:143557 35/136 (26%)
Frizzled 210..509 CDD:279827
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 499..504
PDZ-binding 535..537
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.