| Sequence 1: | NP_001245577.1 | Gene: | CG1632 / 31763 | FlyBaseID: | FBgn0030027 | Length: | 1056 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_067432.2 | Gene: | Fzd1 / 14362 | MGIID: | 1196625 | Length: | 642 | Species: | Mus musculus |
| Alignment Length: | 264 | Identity: | 66/264 - (25%) |
|---|---|---|---|
| Similarity: | 91/264 - (34%) | Gaps: | 77/264 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 353 LIEEPIM------SSSPLGGHDETTEPVVTTTPAPPRR------------------CSPLELSYC 393
Fly 394 RQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPCDTHGSDLQPTPG 458
Fly 459 QICREYCESFMAGC-------GGRLPQRFRQFFDCERFPESTGTQSCHQKPHCVSDMQSNVQSPR 516
Fly 517 LCDGYADCPDLSDERSCAFCSPNALYCGRG-RACVPRKARC--DGKADCPDG-----------AD 567
Fly 568 EKDC 571 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1632 | NP_001245577.1 | SEA | 232..327 | CDD:279699 | |
| CRD_FZ | 384..502 | CDD:143549 | 37/142 (26%) | ||
| PRKCSH-like | <503..>582 | CDD:193472 | 22/83 (27%) | ||
| LDLa | 536..571 | CDD:238060 | 12/48 (25%) | ||
| Tryp_SPc | 708..>809 | CDD:304450 | |||
| Fzd1 | NP_067432.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 26..45 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 76..99 | 4/27 (15%) | |||
| CRD_FZ1 | 107..233 | CDD:143574 | 40/140 (29%) | ||
| 7tmF_FZD1 | 294..641 | CDD:320375 | |||
| TM helix 1 | 313..338 | CDD:320375 | |||
| TM helix 2 | 347..368 | CDD:320375 | |||
| TM helix 3 | 398..424 | CDD:320375 | |||
| TM helix 4 | 441..457 | CDD:320375 | |||
| TM helix 5 | 479..508 | CDD:320375 | |||
| TM helix 6 | 528..555 | CDD:320375 | |||
| TM helix 7 | 591..616 | CDD:320375 | |||
| Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 | 620..625 | ||||
| PDZ-binding | 640..642 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||