DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and AgaP_AGAP004770

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:XP_318046.3 Gene:AgaP_AGAP004770 / 1278456 VectorBaseID:AGAP004770 Length:259 Species:Anopheles gambiae


Alignment Length:364 Identity:73/364 - (20%)
Similarity:111/364 - (30%) Gaps:171/364 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   711 GDWPWLVALFREDIHVCDGTLITQDWVLTTEGCFQGQPRATWMAIVGAVRLSAKAPWTQRRRIIG 775
            |..|:..::....:|||.|::|.|.|||:...|...:|.:.      :||: |.....|..:|:.
Mosquito    40 GAAPFQASVQSHGVHVCGGSIIHQQWVLSAGHCSSKEPNSL------SVRV-ASIHHNQGGQIVN 97

  Fly   776 M---IKSPVEGS------TAALVRLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVAER 831
            :   |:.|:...      ..:|:|||..:::|.:|:.|.||                        
Mosquito    98 VEESIRHPLYDEQLIIDYDVSLLRLEQCLTFSPNVQAIRLP------------------------ 138

  Fly   832 LEGQLVSQQRSRLSQENQQFFLIPSQEQQD---------SSTENQGDEDQDEQEDHFGGESAASY 887
                           ...:||       ||         .:|:|                     
Mosquito   139 ---------------MQDEFF-------QDGTVCVVSGWGATQN--------------------- 160

  Fly   888 MPKAEALHQELDGYPLPDHAP-QVNYYSSSSTVTSSSTAARIATKAPILAAVPAAQEQIWTNCNT 951
             |...:........||.:||. |..|.|:::|:|.....|..                       
Mosquito   161 -PVESSDRLRATDVPLVNHAVCQTAYISAAATITDRMICAGY----------------------- 201

  Fly   952 LGWSRQRDHLQRVQLKMGDMAPCENVSIATVNSMCMEATYQKYDCTQEEYSGAPVQCLIPGTNQW 1016
              :|..||..|      ||                               ||.|:.      .:.
Mosquito   202 --FSGGRDACQ------GD-------------------------------SGGPLY------YEN 221

  Fly  1017 ALIGVSSWRIACGPTG----VERPRMYDKIASNAAWIRE 1051
            .||||.|||     ||    |..|.:|.::||..|||.|
Mosquito   222 TLIGVVSWR-----TGDCAEVNFPGVYSRVASVRAWIYE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 29/106 (27%)
AgaP_AGAP004770XP_318046.3 Tryp_SPc 30..253 CDD:214473 70/360 (19%)
Tryp_SPc 31..256 CDD:238113 73/364 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.