DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and CLIPB2

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:XP_312956.3 Gene:CLIPB2 / 1273920 VectorBaseID:AGAP003246 Length:355 Species:Anopheles gambiae


Alignment Length:515 Identity:103/515 - (20%)
Similarity:154/515 - (29%) Gaps:215/515 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   586 PLVPYLSRFHSAGYAVFSEKG-------------VVGKLCAEGLEGDAKLVV----RQTVSESLC 633
            |||  |:.|   |.:|..|:|             |:.:.||..|...:|...    .|.::.|.|
Mosquito     8 PLV--LALF---GVSVALEQGQRCVNPARQTGKCVLVRECASLLAIYSKRFTTPEETQFLASSRC 67

  Fly   634 KSLGYESVEIFDVQNDTERLNDYVRVLDPHAPEISFIRTHCPRRQVLYVGCGELRCGVQSALFNA 698
            ..:|.:::.....:..| |.:.:     |.:||                      ||:|     .
Mosquito    68 GEIGRKTLVCCASEQQT-RTSSF-----PTSPE----------------------CGIQ-----V 99

  Fly   699 KQHLSLPKMSAPGDWPWLVAL-FRE-----DIHVCDGTLITQDWVLTTEGCFQGQPRATWMAIVG 757
            ...:...:.:...::||...: :|:     |.| |.|.||...::||...|.|..||. |.  :.
Mosquito   100 TDRIIGGQTTELEEFPWTALIEYRKPGNQYDFH-CGGALINARYILTAAHCVQSLPRG-WQ--LN 160

  Fly   758 AVRLSAKAPWTQRRR--------IIGMIKSPVEGSTA---------------ALVRLETPVSYSD 799
            .|||   ..|.....        ..|.|...:|...|               ||:||...|:.|:
Mosquito   161 GVRL---GEWDLSTANDCSDGICSAGPIDLEIESFVAHAGYDAADTAHTNDIALIRLRQDVASSE 222

  Fly   800 HVRPICLPDALQRRLLQQPPAQRRSHVPVAERLEGQLVSQQRSRLSQENQQFFLIPSQEQQDSST 864
            .:||||||                            |...||||                     
Mosquito   223 MIRPICLP----------------------------LTEPQRSR--------------------- 238

  Fly   865 ENQGDEDQDEQEDHFGGESAASYMPKAEALHQELDGYPLPDHAPQVNYYSSSSTVTSSSTAARIA 929
                        :..|..|.|:...|                             |.|::|:...
Mosquito   239 ------------NRVGTVSFAAGWGK-----------------------------TESASASERK 262

  Fly   930 TKAPILAAVPAAQEQIWTNCNTLGWSRQRDHLQRVQLKMGDMAPCENVSIATVNSMCMEATYQKY 994
            .|..:....|:...||:...|             :.||              .:.||......|.
Mosquito   263 LKVELTVQDPSRCRQIYRGIN-------------IALK--------------ASQMCAGGLQGKD 300

  Fly   995 DCTQEEYSGAPVQCLIPGTNQWALIGVSSWRIA-CGPTGVERPRMYDKIASNAAWIRETI 1053
            .||.:  ||.|:.....|.  |.||||.|:.:: ||..|.  |.:|..:.....||...:
Mosquito   301 TCTGD--SGGPLMAKSAGA--WYLIGVVSFGLSKCGTAGY--PGVYTNVVEYLDWIESNV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 36/129 (28%)
CLIPB2XP_312956.3 CLIP 26..78 CDD:288855 9/51 (18%)
Tryp_SPc 102..350 CDD:214473 75/377 (20%)
Tryp_SPc 103..353 CDD:238113 77/379 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24258
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.