DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and FZD10

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_009128.1 Gene:FZD10 / 11211 HGNCID:4039 Length:581 Species:Homo sapiens


Alignment Length:193 Identity:51/193 - (26%)
Similarity:75/193 - (38%) Gaps:35/193 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 RCSPLELSYCRQVGYNITTYPNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPCDT 448
            :|.|:|:..|:.:|||:|..|||:||.:..:.|..:..|..||:..||.....|:|.|..|.|..
Human    33 KCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTE 97

  Fly   449 HGSDLQPTPGQICREYCESFMAGCGGRLPQ---RFRQFFDCERFP-ESTGTQSCHQKPHCVSDMQ 509
            ..|    ||...||..||.....|...:.|   ::....||.:.| ::.....|.:.|:..||..
Human    98 QVS----TPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEP 158

  Fly   510 S----------NVQSPRL---------------CDGYADCPDLSDERSCA-FCSPNA-LYCGR 545
            :          ..|.|..               ||.......:....||| .|:|.. :|..|
Human   159 TRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSR 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 37/121 (31%)
PRKCSH-like <503..>582 CDD:193472 13/70 (19%)
LDLa 536..571 CDD:238060 4/11 (36%)
Tryp_SPc 708..>809 CDD:304450
FZD10NP_009128.1 CRD_FZ10 30..156 CDD:143571 38/126 (30%)
7tmF_FZD10 217..535 CDD:320165 2/5 (40%)
TM helix 1 226..251 CDD:320165
TM helix 2 260..281 CDD:320165
TM helix 3 310..336 CDD:320165
TM helix 4 353..369 CDD:320165
TM helix 5 391..420 CDD:320165
TM helix 6 440..467 CDD:320165
TM helix 7 497..522 CDD:320165
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 526..531
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 560..581
PDZ-binding 579..581
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.