DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1632 and Fzd7

DIOPT Version :9

Sequence 1:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster
Sequence 2:NP_001258114.1 Gene:Fzd7 / 100360552 RGDID:2321905 Length:572 Species:Rattus norvegicus


Alignment Length:359 Identity:91/359 - (25%)
Similarity:123/359 - (34%) Gaps:112/359 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 SSSPLG---------GHDETTEPVVTTTPAPPRR------------CSPLELSYCRQVGYNITTY 403
            |.||||         |      .:.|.|.|.|..            |.|:.:..|..:.||.|..
  Rat     9 SHSPLGLCALVLALLG------ALPTDTGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTIL 67

  Fly   404 PNLLGHASYEQLAEDVIVFRELVDGECHREAYDFVCRLLQPPCDTHGSDLQPTPGQICREYCESF 468
            ||||||.:.|....:|..|..||..:|..|...|:|.:..|.|......:.|     ||..||..
  Rat    68 PNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPP-----CRSLCERA 127

  Fly   469 MAGC-------GGRLPQRFRQFFDCERFPESTGTQSCHQKPHCVSDMQSNV-QSPRLCDGYADCP 525
            ..||       |.:.|:|.|    ||.||.....:.|..:.  .||..... .||   ..|...|
  Rat   128 RQGCEALMNKFGFQWPERLR----CENFPVHGAGEICVGQN--TSDGSGGAGGSP---TAYPTAP 183

  Fly   526 DLSDERSCAFCSPNALYCGRGR-----ACVPRKARCD--------GKADC-----PDGAD----- 567
            .|.|....|. ||:.   ||||     :| ||:.:..        |:.||     |..|:     
  Rat   184 YLPDPPFTAM-SPSD---GRGRWSFPFSC-PRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYF 243

  Fly   568 -EKD---------------CLS----IAPLAADLLQ---PEPLVPYLSR-------FHSAGYAVF 602
             |::               |.|    :.....|:.:   ||..:.:||.       .|.||: :.
  Rat   244 KEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGF-LL 307

  Fly   603 SEKGVVGKLCAEGLEGDAKLVVRQTVSESLCKSL 636
            .::.|    |.|....|....|.|...:..|..|
  Rat   308 EDRAV----CVERFSDDGYRTVAQGTKKEGCTIL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 39/136 (29%)
PRKCSH-like <503..>582 CDD:193472 27/122 (22%)
LDLa 536..571 CDD:238060 15/73 (21%)
Tryp_SPc 708..>809 CDD:304450
Fzd7NP_001258114.1 CRD_FZ7 45..169 CDD:143575 41/134 (31%)
7tmF_FZD7 241..571 CDD:320374 19/102 (19%)
TM helix 1 251..275 CDD:320374 2/23 (9%)
TM helix 2 284..305 CDD:320374 5/20 (25%)
TM helix 3 335..357 CDD:320374 1/3 (33%)
TM helix 4 378..394 CDD:320374
TM helix 5 416..439 CDD:320374
TM helix 6 470..492 CDD:320374
TM helix 7 521..546 CDD:320374
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.