Sequence 1: | NP_001285012.1 | Gene: | sni / 31761 | FlyBaseID: | FBgn0030026 | Length: | 247 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001227.1 | Gene: | CBR3 / 874 | HGNCID: | 1549 | Length: | 277 | Species: | Homo sapiens |
Alignment Length: | 299 | Identity: | 71/299 - (23%) |
---|---|---|---|
Similarity: | 104/299 - (34%) | Gaps: | 118/299 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 LITGCNRGLGLGLVKALLNLPQPPQHLFTTCRN--REQAKELEDLAKNHS-NIHILEID------ 60
Fly 61 -LRNFDAYDKLVADIEGVTKDQ-GLNVLFNNAGIAPKS---------ARIT------AVRS--QE 106
Fly 107 LLDTLQTNTVVPIMLAKACL-------------------------PLLKKAAKANESQ------- 139
Fly 140 ---PMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMCVSLHPGW 201
Fly 202 VKTDMGGSSA-----------------PLDVPTSTGQIV 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sni | NP_001285012.1 | carb_red_sniffer_like_SDR_c | 4..247 | CDD:187586 | 71/299 (24%) |
adh_short | 4..209 | CDD:278532 | 65/266 (24%) | ||
CBR3 | NP_001227.1 | carb_red_PTCR-like_SDR_c | 6..277 | CDD:187585 | 71/299 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG53570 | |
OrthoDB | 1 | 1.010 | - | - | D466834at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X192 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.930 |