DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and CBR3

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001227.1 Gene:CBR3 / 874 HGNCID:1549 Length:277 Species:Homo sapiens


Alignment Length:299 Identity:71/299 - (23%)
Similarity:104/299 - (34%) Gaps:118/299 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LITGCNRGLGLGLVKALLNLPQPPQHLFTTCRN--REQAKELEDLAKNHS-NIHILEID------ 60
            |:||.|||:||.:.:.|..  |....:..|.|:  |.||...:..|:..| ..|.|:||      
Human     9 LVTGANRGIGLAIARELCR--QFSGDVVLTARDVARGQAAVQQLQAEGLSPRFHQLDIDDLQSIR 71

  Fly    61 -LRNFDAYDKLVADIEGVTKDQ-GLNVLFNNAGIAPKS---------ARIT------AVRS--QE 106
             ||:|            :.|:. |||||.|||.:|.||         |.:|      |.|:  .|
Human    72 ALRDF------------LRKEYGGLNVLVNNAAVAFKSDDPMPFDIKAEMTLKTNFFATRNMCNE 124

  Fly   107 LLDTLQTNTVVPIMLAKACL-------------------------PLLKKAAKANESQ------- 139
            ||..::.:..|..:.:..||                         .|:||..:..:::       
Human   125 LLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMKKFVEDTKNEVHEREGW 189

  Fly   140 ---PMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMCVSLHPGW 201
               |.||.:..:..:|.||                        .:.|.......||:..:..||.
Human   190 PNSPYGVSKLGVTVLSRIL------------------------ARRLDEKRKADRILVNACCPGP 230

  Fly   202 VKTDMGGSSA-----------------PLDVPTSTGQIV 223
            |||||.|..:                 |.|.....||:|
Human   231 VKTDMDGKDSIRTVEEGAETPVYLALLPPDATEPQGQLV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 71/299 (24%)
adh_short 4..209 CDD:278532 65/266 (24%)
CBR3NP_001227.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 71/299 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D466834at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X192
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.