DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and HSD17B6

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_003716.2 Gene:HSD17B6 / 8630 HGNCID:23316 Length:317 Species:Homo sapiens


Alignment Length:211 Identity:47/211 - (22%)
Similarity:90/211 - (42%) Gaps:21/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLRNFDAYD 68
            :.||||:.|.|..|.:   .|......:...|...:.|::|.  .:....:..:.:|:...::..
Human    32 VFITGCDSGFGNLLAR---QLDARGLRVLAACLTEKGAEQLR--GQTSDRLETVTLDVTKMESIA 91

  Fly    69 KLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLLKKAA 133
            .....::....|:||..|.|||||.........:.:::.::.|:.|.:..|.:..:.|||:::| 
Human    92 AATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRA- 155

  Fly   134 KANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMCVSLH 198
                       |..|:|:|||||.:.....|    |..||..:.|.:..|..::....:....:.
Human   156 -----------RGRIVNVSSILGRVAFFVGG----YCVSKYGVEAFSDILRREIQHFGVKISIVE 205

  Fly   199 PGWVKTDMGGSSAPLD 214
            ||:.:|.|...:..|:
Human   206 PGYFRTGMTNMTQSLE 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 47/211 (22%)
adh_short 4..209 CDD:278532 46/204 (23%)
HSD17B6NP_003716.2 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 47/211 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.