DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and YMR226C

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_013953.1 Gene:YMR226C / 855266 SGDID:S000004839 Length:267 Species:Saccharomyces cerevisiae


Alignment Length:246 Identity:58/246 - (23%)
Similarity:103/246 - (41%) Gaps:36/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELE---DLAKNHSNIHILEIDLRNF 64
            ::||||.:.|:|.......|........|....|..|:.:||:   |....::.:|:.::|:...
Yeast    15 TVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTIDQEFPNAKVHVAQLDITQA 79

  Fly    65 DAYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLL 129
            :.....:.::....||  :::|.||||.|..|.|:..:.::::.|...||....|.:.:|.||:.
Yeast    80 EKIKPFIENLPQEFKD--IDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALINITQAVLPIF 142

  Fly   130 KKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMC 194
            :.....:           |:|:.||.|. .....|.:|.  .||.|:.|.|.||..:|...:|..
Yeast   143 QAKNSGD-----------IVNLGSIAGR-DAYPTGSIYC--ASKFAVGAFTDSLRKELINTKIRV 193

  Fly   195 VSLHPGWVKTDMGGSSAPLDVPTSTGQIVQTISKLGEKQNGGFVNYDGTPL 245
            :.:.||.|:|:.                 ..:...|.::....|..|.|||
Yeast   194 ILIAPGLVETEF-----------------SLVRYRGNEEQAKNVYKDTTPL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 58/245 (24%)
adh_short 4..209 CDD:278532 52/207 (25%)
YMR226CNP_013953.1 SDR_c5 14..266 CDD:187604 58/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.